DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: side-VII and SIRPG

Sequence 1:NP_001262432.1 Gene:side-VII FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_061026.2 Gene:SIRPG HGNCID:15757 Length:387 Species:Homo sapiens

Alignment Length:372 Identity:81/373 (22%)
Similarity:135/373 (36%) Gaps:112/373 (30%)


  Fly     5 LLFMLALQLIESSIGSKDVPIHQIESI----VGENIYLPCNVTTYDGDEPVLVLWYRDDKGTPIY 65
            ||..|.|.|.|.: |.:::.:.|.|.:    ||:...|.|.||:.....|  |||:|        
Human    15 LLLTLLLGLTEVA-GEEELQMIQPEKLLLVTVGKTATLHCTVTSLLPVGP--VLWFR-------- 68

  Fly    66 SIDIRAGVSKAPKRWSDDSVFGDRAYFIFDKEPG-------------------KLSIQNTQASDS 111
                  ||             |.....|::::.|                   .:.|.:...:|.
Human    69 ------GV-------------GPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADV 114

  Fly   112 GTYRCRVDFLKAQTINSRIRLNVISPPKQVIIRDSSNVERS--------TVVGPYSE---GDIVS 165
            |||.| |.|.|..             |:.|..:.....|.:        .|:||.:.   ...||
Human   115 GTYYC-VKFRKGS-------------PENVEFKSGPGTEMALGAKPSAPVVLGPAARTTPEHTVS 165

  Fly   166 LKCQVIGGYPTP-TISWYRDGIEIPCELSHLAGGKIIECEITLPSLGREDLNS-RLTCRALSHP- 227
            ..|:..|..|.. |:.|:::|.|:.            :.:..:...|:....| |.|.|.:..| 
Human   166 FTCESHGFSPRDITLKWFKNGNELS------------DFQTNVDPTGQSVAYSIRSTARVVLDPW 218

  Fly   228 --RAPIVEAVVQIDMNFAPLN--------IR----LLGAHQPLSAGRRYDLLCQSAGSRPPAV-I 277
              |:.::..|..:.:...||.        ||    |....||:..|.:.::.||.....|.:: :
Human   219 DVRSQVICEVAHVTLQGDPLRGTANLSEAIRVPPTLEVTQQPMRVGNQVNVTCQVRKFYPQSLQL 283

  Fly   278 TWWQNGIRLEKTTETT---SSDGNQT-TSTLSISLSKSDAGKYLSCK 320
            ||.:||...::.|.:|   :.||... ||...:::|.......|:|:
Human   284 TWSENGNVCQRETASTLTENKDGTYNWTSWFLVNISDQRDDVVLTCQ 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 25/121 (21%)
V-set 32..134 CDD:284989 25/121 (21%)
IGc2 160..>214 CDD:197706 10/58 (17%)
Ig 262..328 CDD:299845 16/65 (25%)
IG_like 264..323 CDD:214653 16/63 (25%)
IGc2 360..425 CDD:197706
Ig_3 456..519 CDD:290638
FN3 538..620 CDD:238020
FAM176 643..741 CDD:291517
SIRPGNP_061026.2 IgV_SIRP 33..143 CDD:319346 30/153 (20%)
IgC_SIRP_domain_2 145..248 CDD:319314 22/115 (19%)
IgC_SIRP_domain_3 250..353 CDD:319334 20/82 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.