DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: side-VII and Btnl2

Sequence 1:NP_001262432.1 Gene:side-VII FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_524574.1 Gene:Btnl2 MGIID:1859549 Length:514 Species:Mus musculus

Alignment Length:638 Identity:117/639 (18%)
Similarity:200/639 (31%) Gaps:208/639 (33%)


  Fly    32 VGENIYLPCNVTTYDGDEPVLVLWYRDDKGTPIYSIDIRAGVSKAPKRWSDDSVFGDRAYFIFDK 96
            |||:..|.|.:........:.|.|||.|...|:......|.|:..|...     :|.||.::.|.
Mouse    42 VGEDALLTCQLLPKRTTAHMEVRWYRSDPDMPVIMYRDGAEVTGLPMEG-----YGGRAEWMEDS 101

  Fly    97 -EPGK--LSIQNTQASDSGTYRCRV---DFLKAQTINSRIRLNVISPPKQVIIRDSSNVERSTVV 155
             |.|.  |.|:..|.||.|.|.||.   |:.:..::..::          ..:..|.|:.    |
Mouse   102 TEEGSVALKIRQVQPSDDGQYWCRFQEGDYWRETSVLLQV----------AALGSSPNIH----V 152

  Fly   156 GPYSEGDIVSLKCQVIGGYPTPTISWYRDGI----EIPCELSHLAG-GKIIECEITLPSLGREDL 215
            ....||: |.|.|...|.:|.|.:.|  :||    .:....:|:.| ..:...|.||  :.|.|.
Mouse   153 EGLGEGE-VQLVCTSRGWFPEPEVHW--EGIWGEKLMSFSENHVPGEDGLFYVEDTL--MVRNDS 212

  Fly   216 NSRLTCRALSHPRAPIVEAVVQID--MNFAPLNIRLLGAHQ--PLSAGRRYDLLCQSAGSRPPAV 276
            ...::|...||......||.:.:.  :.....::.::|..|  |:..|...:|.|          
Mouse   213 VETISCFIYSHGLRETQEATIALSERLQTELASVSVIGHSQPSPVQVGENIELTC---------- 267

  Fly   277 ITWWQNGIRLEKTTETTSSDGNQTTSTLSISLSKSDAGKYLSCKAYNHAVP---SEPLEDGWKLD 338
                                                           |..|   ::.||..| |.
Mouse   268 -----------------------------------------------HLSPQTDAQNLEVRW-LR 284

  Fly   339 IQYVPEAYVRLGTSLDPSTLREGTDVYFDCLVMAHPNVFRIEWRHNEQPLSHNISLGVIISNHSL 403
            .:|.|..:|          ...||.|..:.:|         |::.....::..|..|.:    :|
Mouse   285 SRYYPAVHV----------YANGTHVAGEQMV---------EYKGRTSLVTDAIHEGKL----TL 326

  Fly   404 VLQGVTRATAGNYSCVGFNAEGEGISAPFALNILYAPTCAQNQKKVYGIAKQEDAKVMCTVDANP 468
            .:.....:..|.|.|: |..:|....|...:.::...:..:..::|   .|....::.||.|...
Mouse   327 QIHNARTSDEGQYRCL-FGKDGVYQEARVDVQVMAVGSTPRITREV---LKDGGMQLRCTSDGWF 387

  Fly   469 REVEFSW------TFNNSAESIDVATNHIIRSGTTSIVTYTPITELDYGTLLCLASNKIGKQRVP 527
            ......|      |..:.:|:....:..:.:..|..:||                          
Mouse   388 PRPHVQWRDRDGKTMPSFSEAFQQGSQELFQVETLLLVT-------------------------- 426

  Fly   528 CVFHIIAAGRPEKVHNCTVNNISMTSLTVTCSDGFNGGLPQSFNLELLDSYTQEIKANITSTIPK 592
                                |.||  :.||||.....|..::....|.||..    |.:..|:|.
Mouse   427 --------------------NGSM--VNVTCSISLPLGQEKTARFPLSDSKI----ALLWMTLPV 465

  Fly   593 FTVPGLSPGSIYRLNIYAFNTKGRSDPAIVNAAMLRMPEKQLTSEQTHNLRAE 645
            ..:                       |..:...::::...:.|:||||:...|
Mouse   466 VVL-----------------------PLAMAIDLIKVKRWRRTNEQTHSSNQE 495

Known Domains:


GeneSequenceDomainRegion External IDIdentity
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 30/108 (28%)
V-set 32..134 CDD:284989 30/108 (28%)
IGc2 160..>214 CDD:197706 17/59 (29%)
Ig 262..328 CDD:299845 4/69 (6%)
IG_like 264..323 CDD:214653 2/59 (3%)
IGc2 360..425 CDD:197706 12/65 (18%)
Ig_3 456..519 CDD:290638 9/69 (13%)
FN3 538..620 CDD:238020 15/82 (18%)
FAM176 643..741 CDD:291517 1/4 (25%)
Btnl2NP_524574.1 IG_like 37..141 CDD:214653 30/104 (29%)
Ig_MOG_like 43..142 CDD:143190 29/114 (25%)
IG_like 257..358 CDD:214653 26/183 (14%)
Ig_MOG_like 260..358 CDD:143190 26/180 (14%)
Ig <379..444 CDD:299845 17/113 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.