DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: side-VII and Nphs1

Sequence 1:NP_001262432.1 Gene:side-VII FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_062332.2 Gene:Nphs1 MGIID:1859637 Length:1256 Species:Mus musculus

Alignment Length:968 Identity:201/969 (21%)
Similarity:325/969 (34%) Gaps:314/969 (32%)


  Fly    33 GENIYLPCNVTTYDGDEPVLVLWYRDDK------GT----------------------------- 62
            |||:.|||  ....|:.|..:.|.::.|      ||                             
Mouse   272 GENLELPC--IARGGNPPATLQWLKNGKPVSIAWGTEHAQAVAHSVLVMTVRPEDHGARLSCQSY 334

  Fly    63 ------------------PIYSIDIRAGVSKA---------------PK---RW---------SD 82
                              |..::.|....|::               |:   ||         :|
Mouse   335 NSVSAETQERSITLQVTFPPSAVTILGSTSQSENKNVTLCCLTKSSRPRVLLRWWLGGRQLLPTD 399

  Fly    83 DSVFGDRAYFIFDKEPGKLSIQN----TQASDSG-TYRCRV--DFLKAQTINSRIRLNVISPPKQ 140
            ::|..       ....|.:|:.|    .:..|:| :..|..  |....:|....:.|||..|.::
Mouse   400 ETVMD-------GLHGGHISMSNLTLLVKREDNGLSLTCEAFSDAFSKETFKKSLTLNVKYPAQK 457

  Fly   141 VIIRDSSNVERSTVVGP-----YSEGDIVSLKCQVIGGYPTPTISWYRDG--IEIP--------C 190
            :.|.           ||     ...|..|.|.|..|||.|.|:::|.:|.  :..|        .
Mouse   458 LWIE-----------GPPEGQSIRTGTRVRLVCLAIGGNPEPSLTWLKDSRPVNDPRQSQEPRRV 511

  Fly   191 ELSHL-AGGKIIECEITLPSLGREDLNSRLTCRALSHPRAPIVEAVVQIDMNFAPLNIRLLGAHQ 254
            :|..: ..|.....|:.| .:|..|..::.:|:|..      :.|..|:.:.|.|.|:.:|....
Mouse   512 QLGSVEKSGSTFSRELVL-IIGPPDNLAKFSCKAGQ------LSASTQLVVQFPPTNLTILANSS 569

  Fly   255 PLSAGRRYDLLCQSAGSRPPAVITWWQNGIRLEKTTETTSS---DGNQTTSTLSISLSKSDAGKY 316
            .|..|...:|.|.|..|.||..::..:.|.||:.......|   .|:..:.::.:.:|..|.|..
Mouse   570 ALRPGDALNLTCVSISSNPPVNLSLDKEGERLDDVAAKPQSAPFKGSAASRSVFLRVSSRDHGHR 634

  Fly   317 LSCKAYNHAVPSEPLEDGWKLDIQYVPEAYVRLGTSLDPSTLREGTDVYFDCLVMAHPNVFRIEW 381
            ::|:|::.|: .|.:...::|::.|.||.   ||..:...|:.|.........|.|:|......|
Mouse   635 VTCRAHSEAL-RETVSSFYRLNVLYPPEF---LGEQVRAVTVVEQGQALLPVSVSANPAPEAFNW 695

  Fly   382 RHNEQPLS------HNISLGVIISNHSLVLQGVTRATAGNYSCVGFNAEGEGISAPFALNILYAP 440
            ......||      |.     |:|..:|.|..||||..|.|.....|:||.. .|...|::.|||
Mouse   696 TFRGYRLSPAGGPRHR-----ILSGGALQLWNVTRADDGFYQLHCQNSEGTA-EALLKLDVHYAP 754

  Fly   441 TC-AQNQKKVYGIAKQEDAKVMCTVDANP------------------------------------ 468
            |. |........:....|  ::|||||||                                    
Mouse   755 TIRALKDPTEVNVGGSVD--IVCTVDANPILPEMFSWERLGEDEEELNLDDMEKMSKGSTGRLRI 817

  Fly   469 ----------------------------------------------------------------- 468
                                                                             
Mouse   818 RQAKLSQAGAYQCIVDNGVAPAARGLVRLVVRFAPQVDHPTPLTKVAAAGDSTSSATLHCRARGV 882

  Fly   469 REVEFSWTFNNSAESIDVA----TNHIIRSGT--TSIVTYTPITEL-DYGTLLCLASNKIGKQRV 526
            ..::|:||.|  ...:|:.    |.|....|.  :|::|...::.. ||....|.|:|.:|....
Mouse   883 PNIDFTWTKN--GVPLDLQDPRYTEHKYHQGVVHSSLLTIANVSAAQDYALFKCTATNALGSDHT 945

  Fly   527 PCVFHIIAAGRPEKVHNCTVNNISMTSLTVTCSDGFNGGLPQSFNL--ELLDS----YTQEIKAN 585
            .  ..:::..||:......|.::|..|:.:....||:|||||.|.:  |.|:|    |...:.|.
Mouse   946 N--IQLVSISRPDPPLGLKVVSVSPHSVGLEWKPGFDGGLPQRFQIRYEALESPGFLYMDVLPAQ 1008

  Fly   586 ITSTIPKFTVPGLSPGSIYRLNIYAFNTKGRS-------DPAIVNAAMLRMPE---KQLTSEQTH 640
            .|:    ||:.||.|.:.||:.:.|.|..|.|       ..:|....:.:.||   :.|.:||..
Mouse  1009 ATT----FTLTGLKPSTRYRIWLLASNALGDSGLTDKGIQVSITTPGLDQAPEDTDQPLPTEQPP 1069

  Fly   641 NLRAELLFSPVMSLTIGLTLAVLVAVLAIILALRIPCTASS--RRRQKELSNENISRDESPGPSD 703
            .       .|.:.|     |.||.||..::|.....|....  |||.:.|:.|...:.|:....|
Mouse  1070 G-------PPRLPL-----LPVLFAVGGLLLLSNASCVGGLLWRRRLRRLAEEISEKTEAGSEED 1122

  Fly   704 KSSGSKE----VDDCDEKNPDVVPESIEPDEQA------------ESIRKRQQISTID 745
            :.....|    ..|.|.::..|....::|...:            |.:..||..:.|:
Mouse  1123 RIRNEYEESQWTGDRDTRSSTVSTAEVDPHYYSMRDFSPQLPPTLEEVSYRQAFTGIE 1180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 30/188 (16%)
V-set 32..134 CDD:284989 30/188 (16%)
IGc2 160..>214 CDD:197706 17/65 (26%)
Ig 262..328 CDD:299845 17/69 (25%)
IG_like 264..323 CDD:214653 16/62 (26%)
IGc2 360..425 CDD:197706 20/71 (28%)
Ig_3 456..519 CDD:290638 22/171 (13%)
FN3 538..620 CDD:238020 29/95 (31%)
FAM176 643..741 CDD:291517 24/116 (21%)
Nphs1NP_062332.2 Ig 52..128 CDD:299845
IG_like 52..127 CDD:214653
C2-set_2 155..242 CDD:285423
Ig 254..332 CDD:299845 12/62 (19%)
IG_like 268..350 CDD:214653 12/80 (15%)
C2-set_2 358..440 CDD:285423 14/89 (16%)
Ig 459..544 CDD:299845 22/97 (23%)
I-set 460..555 CDD:254352 25/113 (22%)
Ig 563..646 CDD:299845 20/84 (24%)
IG_like 670..750 CDD:214653 24/86 (28%)
Ig 676..750 CDD:299845 22/80 (28%)
Ig_3 753..834 CDD:290638 12/83 (14%)
IG_like 762..848 CDD:214653 8/88 (9%)
Ig 848..956 CDD:299845 18/112 (16%)
IG_like 859..949 CDD:214653 16/94 (17%)
fn3 956..1039 CDD:278470 28/87 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3515
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.