DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: side-VII and hbs

Sequence 1:NP_001262432.1 Gene:side-VII FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_001286439.1 Gene:hbs FlyBaseID:FBgn0029082 Length:1235 Species:Drosophila melanogaster

Alignment Length:1059 Identity:216/1060 (20%)
Similarity:355/1060 (33%) Gaps:315/1060 (30%)


  Fly    33 GENIYLPCNVTTYDGDEPVLVLWYR--------------------------DDKG---------- 61
            |:.:.:.|.  :..|:.|..:.|||                          :|.|          
  Fly   266 GQEVQIACR--SRGGNPPAQLTWYRNGVAISSPQRTSGRLSENVYKFTAAAEDNGANLVCEAKNL 328

  Fly    62 ---TPIYSIDIRAGVSKAPK----RWSDDSVFGDRAYFIFDKEPGKLSIQ-----NTQASDSGTY 114
               ||:.: ::...|..|||    ..::.:..||.........|.....:     |.:..|:.||
  Fly   329 LATTPLRA-ELNLTVLYAPKDVYLSGANQAKVGDSVQLSCVTAPSNPQARISWSINGRPLDNSTY 392

  Fly   115 RCRVDFLKAQTINSRIRLNVISPPKQVI-IRDSSNVE-RSTVVGP----------------YSEG 161
            :...........:|.|.|.:.|..:..| :..:.|.| ...|||.                |::|
  Fly   393 KTTSSSDGGWVSSSNISLTIDSQSRTFIAVCHALN
TELTQNVVGSHTVNVLYPPSPPLLTGYNDG 457

  Fly   162 D------IVSLKCQVIGGYPTPTISWYRDG--IEIPCELSHLAGGKIIECEITLPSLGREDLNSR 218
            |      |:.|:|...||.|.||:.||::.  |..|   |.|...||.. |::| .:...|.|:.
  Fly   458 DILISGSILKLQCSSAGGNPPPTLQWYKNDKIINAP---SKLVDSKITS-ELSL-LVNASDNNAI 517

  Fly   219 LTCR----ALSHPRAPIVEAVVQIDMNFAPLNIRLLGAHQPLSAGRRYDLLCQSAGSRPPAVITW 279
            ..|:    |:..|    :.|...:.::|.|..:::....:.|..|.|..|:|.|:.|.|||.|:|
  Fly   518 YKCKVQNAAIDIP----LFATKTLGVHFPPETVKISVVPKNLVPGIRAKLICDSSSSNPPAKISW 578

  Fly   280 WQNGIRLEKTTETTSS---DGNQTTSTLSISLSKSDAGKYLSCKAYNHAVPSEPLEDGWKLDIQY 341
            |::||.:|........   .|:.:|..:.:::::...|...:|:::|. |....:.:...|||.|
  Fly   579 WKDGIPVEGLNLANRPGLWGGSVSTLEMYVNITQDLDGIVYTCQSHNE-VLQRSVHETISLDILY 642

  Fly   342 -----VPEAYVRLGTSLDPSTLREGTDVYFDCLVMAHPNVFRIEWRHNEQPLSHNISLG--VIIS 399
                 .|::...:|.        ||...:.:.|...:|.|....|..:..|:|.|...|  :|..
  Fly   643 PPKFETPQSTTFVGV--------EGAPFHVELLASGNPMVITYTWTKDGLPISSNSLSGQRLISD 699

  Fly   400 NHSLVLQGVTRATAGNYSCVGFNAEGEGISAPFALNILYAPT---CAQNQKKVYGIAKQEDAKVM 461
            ...|.:..::|..||.|.|...|::|..: ....:.:.||||   .::.:..|.|    |.|.:.
  Fly   700 GPRLNISRLSRNDAGVYICEALNSQGTAL-LEIQVAVEYAPTITAVSEGRSFVAG----EPAVLA 759

  Fly   462 CTVDANPRE-VEFSWTFNNSAESIDVATNHI--IRSGT----------TSIVTYTPITEL----- 508
            |.:.|.|.| ....|    |.:..|:||..|  ..:||          :.|..:|.|.:.     
  Fly   760 CHIQARPLEAAHVRW----SRDGYDLATRTISSFENGTALLQIASVERSDIGNFTCIVDNQRGAP 820

  Fly   509 ----------------------------------------------------------------- 508
                                                                             
  Fly   821 AAQNVLLVVQTAPEIDHSPGFTRYAARLGVRAQLICRSLASPQPSFIWRRHGKDLKMQRRNKFKS 885

  Fly   509 ----------------------DYGTLLCLASNKIGKQRVPCVFHIIAAGRPEKVHNCTVNNISM 551
                                  |||...|:..|.:|:......|.  ...||:......|.|:|.
  Fly   886 VERQVDALNFESALLIENTSPDDYGQYECVVRNSLGQASTTLEFS--KPSRPDAPLQLRVGNVSD 948

  Fly   552 TSLTVTCSDGFNGGLPQSFNLELLDSYTQEIKANITSTIP---KFTVPGLSPGSIYRLNIYAFNT 613
            |.:.:..:.||:||:...|.|.|  ....|.|.......|   ..::.||.||:.|..::.|.|.
  Fly   949 TGVDLNWTPGFDGGMQTYFRLRL--KQHGEDKYKYVDAKPGHQNISLDGLKPGATYYFSVMAANE 1011

  Fly   614 KGRSDPAIVNAAMLRMPEKQLT---SEQTHNLRAELLFSPVMS--LTIGLTLAVLVAVLAIILAL 673
            .|.|.         .||:.:||   ..|.|:  ||......:.  :.||:|.|   |::.::|..
  Fly  1012 AGGSK---------FMPDIKLTLSKGSQPHS--AEYTEKDELPNVMIIGITSA---AMVLLVLNA 1062

  Fly   674 RIPCTASSRRRQKELSNENISRDESPGPSDKSSGSKEVDDCDEKNPDVVP-ESIEPDEQAESIRK 737
            .:......||:.|..|....|.|:.....|..|..|            :| .:::.|.|.::...
  Fly  1063 ALVAWFVIRRQNKSQSEAEPSNDDVYSKDDSQSVYK------------LPITALQADVQKKAAAS 1115

  Fly   738 RQQISTIDTNRSPNRGIFVNEQQHLTAAEISLRASHGIGYCTLRSGMHAQAQSSVGEISINVTPH 802
            ...:..:|..:|             ||.....:.|   ..||                    .|:
  Fly  1116 TYLVENVDIIQS-------------TAYPPKYQES---SMCT--------------------PPY 1144

  Fly   803 VYSNSISQCTLPRQSSQNVWNNYNCNITGARPTSTFHQLTFPQGRVNVGGHNPAQPLHGHAPSPS 867
            ...|.....|||.....:..|:....|.|.:..|....:....|.              :.||||
  Fly  1145 PLCNPDFTRTLPNPKRHSQRNSATGMIEGMQMRSKDDHMLISNGL--------------YIPSPS 1195

  Fly   868 QASNSSMASSTNTLPQPHP 886
            .||:..:..|..:.|.|.|
  Fly  1196 PASSLVIKGSYISSPSPAP 1214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 25/149 (17%)
V-set 32..134 CDD:284989 25/149 (17%)
IGc2 160..>214 CDD:197706 20/62 (32%)
Ig 262..328 CDD:299845 19/69 (28%)
IG_like 264..323 CDD:214653 17/62 (27%)
IGc2 360..425 CDD:197706 18/67 (27%)
Ig_3 456..519 CDD:290638 21/168 (13%)
FN3 538..620 CDD:238020 24/85 (28%)
FAM176 643..741 CDD:291517 20/101 (20%)
hbsNP_001286439.1 Ig 44..122 CDD:299845
IG_like 45..137 CDD:214653
Ig 153..231 CDD:299845
IG_like 258..342 CDD:214653 11/79 (14%)
Ig 266..327 CDD:299845 9/63 (14%)
IG_like 357..>414 CDD:214653 10/57 (18%)
Ig 360..427 CDD:299845 12/67 (18%)
Ig <468..526 CDD:299845 20/63 (32%)
I-set 547..633 CDD:254352 22/87 (25%)
Ig 556..631 CDD:299845 21/76 (28%)
I-set 644..735 CDD:254352 21/100 (21%)
IGc2 668..725 CDD:197706 15/57 (26%)
IG_like 751..829 CDD:214653 19/86 (22%)
IGc2 753..815 CDD:197706 18/70 (26%)
Ig 852..928 CDD:143165 6/76 (8%)
FN3 935..1017 CDD:238020 24/93 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.