DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: side-VII and side-VI

Sequence 1:NP_001262432.1 Gene:side-VII FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_001036705.1 Gene:side-VI FlyBaseID:FBgn0083950 Length:1087 Species:Drosophila melanogaster

Alignment Length:1082 Identity:335/1083 (31%)
Similarity:517/1083 (48%) Gaps:208/1083 (19%)


  Fly    31 IVGENIYLPCNVTTYDGDEPV-LVLWYRDDKGTPIYSIDIRAGVSKAPKRWSDDSVFGDRAYFIF 94
            :|..:..:.|:|.:...|:.| ||:||:::  .||||.|.|...:..|..|.|:.|..|||.|..
  Fly    38 LVNSSAQIKCDVGSSQADDKVLLVVWYKNN--LPIYSYDTRGAHAGTPSHWRDEEVLEDRAVFRT 100

  Fly    95 DKEPGKLSIQNTQASDSGTYRCRVDFLKAQTINSRIRLNVISPPKQVIIRDSSNVERSTVVGPYS 159
            .|||.:|.|...:..|:|.:||||||..:||.||.:.|.|:.||.|.||.:...:...:..|||.
  Fly   101 HKEPAELIINPVKEKDAGNFRCRVDFKLSQTRNSNVNLEVVVPPTQPIIFNERRLRIDSRAGPYE 165

  Fly   160 EGDIVSLKCQVIGGYPTPTISWYRDGIEIPCELSHLAGGKIIECEITLPSLGREDLNSRLTCRAL 224
            ||..:.:.|.|.||.|.||:.|..:| ::...:........|..::.:.:|.|...::..||:| 
  Fly   166 EGGSLEVTCVVYGGSPPPTVIWLMNG-QLQNSVVDYTYDGAINSKLVVRNLSRIHQHAVYTCQA- 228

  Fly   225 SHPRAPIVEAVVQIDMNFAPLNIRLLGAHQPLSAGRRYDLLCQSAGSRPPAVITWWQNGIRLEKT 289
            |:.....|...:.||:...||.:.:...:||:||.|:|::.||:.||||||.||||...:.|...
  Fly   229 SNFHKKYVATNITIDLYLRPLLVEISFNNQPMSADRKYEIECQAIGSRPPAKITWWMGNLELHGH 293

  Fly   290 TETTSSDGNQTTSTLSISLSKSDAGKYLSCKAYNHAVPSEPLEDGWKLDIQYVPEAYVRLGTSLD 354
            ::..|.|||.:||.|||:.::.|.||.|||:|.|..|.:...|...||::.::|...:.||::|:
  Fly   294 SQKVSEDGNVSTSVLSITPTREDHGKALSCRATNELVRNGIRETAMKLNVFFIPTLQLDLGSNLN 358

  Fly   355 PSTLREGTDVYFDCLVMAHPNVFRIEWRHNEQPLSHNISLGVIISNHSLVLQGVTRATAGNYSCV 419
            |..:.||.||||:|.|.|:|..:::.|:||.|.:.||...|||:|:..|.||||||..||||:|.
  Fly   359 PEDIEEGDDVYFECKVHANPAAYKVVWKHNHQIIQHNQRAGVIVSSGDLALQGVTRHQAGNYTCT 423

  Fly   420 GFNAEGEGISAPFALNILYAPTCAQNQKKVYGIAKQEDAKVMCTVDANPREVEFSWTFNNSAESI 484
            ..|.||:|.|....|.::|.|.|..:|||:||:|:.|.|:::|.|||.|....|.|:|||:||:.
  Fly   424 ASNVEGDGDSNVVELKVMYKPICRPDQKKIYGVARNEAAEIVCEVDAFPPPENFKWSFNNTAETF 488

  Fly   485 DVATN----HIIRSGTTSIVTYTPITELDYGTLLCLASNKIGKQRVPCVFHIIAAGRPEKVHNCT 545
            |:..:    |   |...|.:||||:.|:|:||::|.|.|.:|:|:.|||||:||||:||...|||
  Fly   489 DMPQSGFRPH---SAQGSTLTYTPVKEMDFGTIMCWADNNVGQQKEPCVFHLIAAGKPEAPTNCT 550

  Fly   546 VNNISMTSLTVTCSDGFNGGLPQSFNLELLDSYTQEIKANITSTIPKFTVPGLSPGSIYRLNIYA 610
            |.|.:..||.|.|.:||:||:.|.|.:|:.|.::.:::|||::.....:|.||..|.::|:.:||
  Fly   551 VVNQTSDSLEVYCIEGFDGGMRQWFLMEIFDQHSGQLQANISAKFAALSVTGLDAGRLFRIYVYA 615

  Fly   611 FNTKGRSDPAIVNAAMLRMPEKQLTSEQTHNLRAE----LLFSPVMSLTIGLTLAVLVAVLAI-- 669
            .|.:||||...::...|:..|||..:..::...|:    ...:|::|  ||:.:.:|||::.|  
  Fly   616 VNGRGRSDAIALDGYTLKAAEKQTVALTSYKGSAQSPDNFELTPILS--IGIFVGILVAIVCIGI 678

  Fly   670 --ILALRIPCTASSRRRQKELSNENISRDESPGPSDK----SSGSKEVDDCDEKNPDVVP-ESIE 727
              |.||::......::::....|...||..:....||    .|.|:|:  .||||||||| ..::
  Fly   679 GTIAALKLRSHKHQQQQKFVHPNAKFSRPGNLQIKDKISLPLSHSEEM--YDEKNPDVVPYNEVD 741

  Fly   728 PDEQAESIRKRQ--QIST------------------IDTNRSPNRGIFVNEQQHLTAAEISL--- 769
            .:.:.:|..:..  .:||                  :..|.:.:.....::...|..||:||   
  Fly   742 GEYKQKSATQTPSGHLSTTSEVEISCKPGSTSGTGIVQANSADSGTYQSSKDDELHYAELSLTNM 806

  Fly   770 -----------RASHGIGYCTLRSGMHAQAQSSVGEISINVTPHVYSNSISQCTLPRQSSQNVWN 823
                       :...|:|  .::..:..|.|...|::.   .||    .:...|||..||..   
  Fly   807 PSGSSGASKKGQPMGGVG--VVQHVVQQQQQQQQGQVQ---HPH----QLLGGTLPHGSSMR--- 859

  Fly   824 NYNCNITGARPTSTFHQLTFPQGRVNVGGHNPAQPLHGHAPSPSQ-------------------- 868
                .:....|.:.    |..:.:.|.||   .|..|.|||.|:.                    
  Fly   860 ----KLLPTIPATA----TLQRHKPNAGG---MQHPHQHAPPPTYDYDYFEEPTIYAQIDAYKTM 913

  Fly   869 -----------------------ASNSSMAS----ST--------NTLPQ--------PHPH--- 887
                                   ||.||..|    ||        .||||        ||.|   
  Fly   914 QVDTGVVVAGVGAGAGSGVNGAGASISSPGSHGTPSTVSPGTVQMYTLPQHPGGYHTLPHNHHAQ 978

  Fly   888 ---------------------GRTIAMHH------------------MNQAQCGRVCI-----GI 908
                                 .:...|||                  ..|...|::.:     |:
  Fly   979 QQMAGGPQNSASMMQMMQQQQQQQQQMHHHPASNMPPSYQQHQQQQQQQQMAHGQMLVSSNSSGL 1043

  Fly   909 AS------------DGIHSAEQNVSDDEVTVQTPLMIKRDST 938
            ||            .|:....::.|.:.|||:||||..:..:
  Fly  1044 ASTTAAVASPSSSLSGLSGVGKSYSREIVTVRTPLMYSQQES 1085

Known Domains:


GeneSequenceDomainRegion External IDIdentity
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 41/103 (40%)
V-set 32..134 CDD:284989 41/103 (40%)
IGc2 160..>214 CDD:197706 14/54 (26%)
Ig 262..328 CDD:299845 32/66 (48%)
IG_like 264..323 CDD:214653 29/59 (49%)
IGc2 360..425 CDD:197706 34/65 (52%)
Ig_3 456..519 CDD:290638 28/67 (42%)
FN3 538..620 CDD:238020 34/82 (41%)
FAM176 643..741 CDD:291517 30/113 (27%)
side-VINP_001036705.1 IG_like 35..140 CDD:214653 41/104 (39%)
Ig_3 157..230 CDD:290638 21/75 (28%)
IG_like 165..242 CDD:214653 19/79 (24%)
Ig 265..343 CDD:299845 35/78 (45%)
IG_like 267..343 CDD:214653 34/76 (45%)
IG_like 363..440 CDD:214653 38/77 (49%)
IGc2 364..429 CDD:197706 34/65 (52%)
IG_like 456..532 CDD:214653 32/79 (41%)
Ig_3 456..524 CDD:290638 29/71 (41%)
fn3 545..622 CDD:278470 30/77 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130793115
eggNOG 1 0.900 E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23278
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.