DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: side-VII and side-III

Sequence 1:NP_001262432.1 Gene:side-VII FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_001036681.1 Gene:side-III FlyBaseID:FBgn0083949 Length:1689 Species:Drosophila melanogaster

Alignment Length:950 Identity:278/950 (29%)
Similarity:430/950 (45%) Gaps:144/950 (15%)


  Fly     4 LLLFMLALQLIESSI--GSKDVPIH--QIESIVGENIYLPCNVTTYDGDEPV-LVLWYRDDKGTP 63
            |.||...:.|....|  ...|.|:.  .:|:::|....|||::.....|:.| :|||:|:..|.|
  Fly    31 LFLFAAHISLTSGQIDWDDDDDPVSTVAVEAVLGRTASLPCDIEPEAKDDRVYMVLWFRESAGKP 95

  Fly    64 IYSIDIRAGVSKAPKRWSDDSVFGDRAYFIFDKEPGKLSIQNTQASDSGTYRCRVDFLKAQTINS 128
            :||.|:|....:....|||.:.||.||||:..::|.|||:.|.|..|.|.|||||||..:.|.|.
  Fly    96 LYSFDVRGRPFEKALYWSDTNSFGPRAYFVTGQQPAKLSVDNIQLDDEGVYRCRVDFQNSPTRNH 160

  Fly   129 RIRLNVISPPKQVIIRDSSNVERSTVVGPYSEGDIVSLKCQVIGGYPTPTISWYRDGIEIPCELS 193
            ||.|.||.||.|:::.|:|..:.:..|||..|||.:.|.|:|.||.|.||::|......:.....
  Fly   161 RINLTVIVPPHQILVYDASGRDVAGAVGPLLEGDNIVLTCEVRGGRPEPTVTWMNGTRTLEAGSG 225

  Fly   194 HLAGGKIIECEITLPSLGREDLNSRLTCRALSHPRAPIVEAVVQIDMNFAPLNIRLLGAHQPLSA 258
            ...|..:....:.:..:.|..||:...|:|.:......||..::|:|...|.::.|....:..::
  Fly   226 VSMGRHVTVNRLEVAQISRSALNNTYRCQASNTKLVAPVERSIRIEMLLKPTSVNLTNKLKVFAS 290

  Fly   259 GRRYDLLCQSAGSRPPAVITWWQNGIRLEKTTETTSSDGNQTTSTLSISLSKSDAGKYLSCKAYN 323
            ..:|:|.|..|||.|...|.|.||....::...:||....:..|||:......|.|..|.|:..|
  Fly   291 NTQYNLTCIVAGSVPDTEIKWTQNNRPFKRGLLSTSQSNGRVISTLTFYPQPEDDGTMLKCEGSN 355

  Fly   324 HAVPSEPLEDGWKLDIQYVPEAYVRLGTSLDPSTLREGTDVYFDCLVMAHPNVFRIEWRHNEQPL 388
            ..:.:..:||...:::.|.|:..:.||::|.|..::||.||||:|.:.::|...||.|.|:.||:
  Fly   356 PRLQNSAIEDSLMMNVIYPPQVTLSLGSTLRPDDIKEGDDVYFECHIKSNPKEHRIMWSHDGQPV 420

  Fly   389 SHNISLGVIISNHSLVLQGVTRATAGNYSCVGFNAEGEGISAPFALNILYAPTCAQNQKKVYGIA 453
            :.|:|.|:|||..|||||.|.|..:|.|:|...|..||..|||..|.|.|||.|:.:...|.|.:
  Fly   421 TQNVSWGIIISTRSLVLQRVGRIHSGFYACSAANDRGETQSAPVNLRIRYAPVCSSSSITVIGAS 485

  Fly   454 KQEDAKVMCTVDANPREVEFSWTFNNSAESIDVATNH------------------IIRSG----- 495
            .:||..:.|.|:::|.|::|.|||:.|.|..:|.:.|                  ::.|.     
  Fly   486 LEEDVPIPCRVNSDPPEIDFEWTFSTSGEHFEVPSGHYATIQDPTMTTTSDVRRTVVESNETHFE 550

  Fly   496 ----TTSIVTYTPITELDYGTLLCLASNKIGKQRVPCVFHIIAAGRPEKVHNCTVNNISMTSLTV 556
                |.|.:.|||..|.|||||.|...|.||||..||||.::.|.:|..:.|||:....:||.::
  Fly   551 SYVETVSELIYTPKGERDYGTLACYGRNAIGKQSDPCVFQVVPAAKPGALRNCTLRPYVVTSASL 615

  Fly   557 TCSD----GFNGGLPQSF--------NLELLDSYTQEIKANITSTIPKFTVPGLSPGSIYRLNIY 609
            ..|:    ..|..||..:        ::|.:.........|...|.|          :..|.|:.
  Fly   616 NSSNQTTMHANQILPTQYGRHESNYPHMEYVRERHNSSGGNNNGTAP----------AAGRNNVA 670

  Fly   610 AFNTKGRSDPAIVNAAMLRMPEKQLTSEQTHNLRAELLFSPVMSLTIGLTLAVLVAVLAIILALR 674
            ..|.:||:     :|...:...||||.:|...|:....|:|      ..|||.:           
  Fly   671 NKNMRGRT-----SAGQAKSNNKQLTQQQLQRLKKRTSFTP------SQTLAAI----------- 713

  Fly   675 IPCTASSRRRQKELS--NENISRDESPGPSDKSSGSKEVDDCDEKNPDVVPESIEPDEQAESIRK 737
                 ..:|::|:||  .:.:.:......:.||.|        :..||..|        |:|.::
  Fly   714 -----ERQRQRKQLSQQQQQLQQQHHQATATKSGG--------DNKPDGSP--------AKSSKQ 757

  Fly   738 RQQISTIDTNRSPNRGIFVNEQQHLTAAEISLRASHGIGYCTLRSGMHAQAQSSVGEISINVTPH 802
            |.:    ..:|.|.   ...:|||....:..|.|:     .::.|....||:|::.      |.|
  Fly   758 RMR----RASRDPQ---IQQQQQHQQQQQHQLHAA-----TSITSSQRKQAESNLS------TSH 804

  Fly   803 VYSNSISQCTLPRQSSQNVWNNYNCNITGARPTSTF-----------HQLTFPQGRVNVGGHNPA 856
            :...|.|.....|.||.|:.:..|   .|.:|...|           ||....|.:.....|| :
  Fly   805 LGKGSSSSSRSRRSSSSNINSKSN---NGKQPAKYFNKRQKNMHKQKHQQKLKQLKGTTNEHN-S 865

  Fly   857 QPLHGHAPSPSQ-------ASNS-----SMASSTNTLPQP 884
            ..:|.:|...|.       |:|.     :.||::.:|..|
  Fly   866 NIIHHYAALSSSLRRRKRLAANDILATVAAASTSASLSSP 905

Known Domains:


GeneSequenceDomainRegion External IDIdentity
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 45/103 (44%)
V-set 32..134 CDD:284989 45/103 (44%)
IGc2 160..>214 CDD:197706 14/54 (26%)
Ig 262..328 CDD:299845 21/66 (32%)
IG_like 264..323 CDD:214653 19/59 (32%)
IGc2 360..425 CDD:197706 31/65 (48%)
Ig_3 456..519 CDD:290638 27/90 (30%)
FN3 538..620 CDD:238020 19/94 (20%)
FAM176 643..741 CDD:291517 18/100 (18%)
side-IIINP_001036681.1 IG_like 59..166 CDD:214653 46/107 (43%)
V-set 59..166 CDD:284989 46/107 (43%)
ig 190..268 CDD:278476 20/78 (26%)
IG_like 192..259 CDD:214653 18/67 (27%)
Ig 296..361 CDD:299845 20/65 (31%)
IG_like 391..468 CDD:214653 37/77 (48%)
IGc2 392..454 CDD:197706 30/62 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23278
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.