DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: side-VII and side

Sequence 1:NP_001262432.1 Gene:side-VII FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_001247334.1 Gene:side FlyBaseID:FBgn0016061 Length:986 Species:Drosophila melanogaster

Alignment Length:984 Identity:273/985 (28%)
Similarity:411/985 (42%) Gaps:188/985 (19%)


  Fly     5 LLFMLALQLI-------ESSIGSKDVPIHQIESIVGENIYLPCNVTTYDGDEPV-LVLWYRDDKG 61
            |:.:..||.:       ||....|::|...:.:.:|:.:.|||::|.....:.| |:||::|..|
  Fly    70 LVLLTCLQQLKSVSADEESQDFQKNIPARLVWAALGKTVELPCDLTPPTSQDSVKLLLWFKDTTG 134

  Fly    62 TPIYSIDIRAGVSKAPKRWSDDSVFGDRAYFIFDKEP--GKLSIQNTQASDSGTYRCRVDFLKAQ 124
            .|:||:|.|.|..|.....:..|..|.|.:|.....|  .:|.|.:.:..|.|.|||||||..:.
  Fly   135 IPLYSLDSRGGNVKLAPHAAIASDLGQRLFFSIGDNPKDSRLQINDVKPEDGGVYRCRVDFFNSP 199

  Fly   125 TINSRIRLNVISPPKQVIIRDSSNVERSTVVGPYSEGDIVSLKCQVIGGYPTPTISWYRDGIEIP 189
            |.|.|..|.::.||::..|.|:...|.|.:.||:.||..:.|.|||.||.|.|.::|:||..|: 
  Fly   200 TRNFRHNLTLVVPPEEPRIFDAQGKEISQMAGPFREGYELFLCCQVRGGRPPPKVTWWRDDTEL- 263

  Fly   190 CELSHLA---GGKIIECEITLPSLGREDLNSRLTCRALSHPRAPIVEAVVQIDMNFAPLNIRLLG 251
            ...||.:   |..::..::.:.:..|:....|:.|||........|...|.:.:...|:.:::..
  Fly   264 IGTSHTSVEEGATVMVNQLLIGTTTRDFYGIRIECRAQGTRLVDPVRKDVTVQVYLKPVRVKIAT 328

  Fly   252 AHQPLSAGRRYDLLCQSAGSRPPAVITWWQNG--IR-LEKTTETTSSDGNQTTSTLSISLSKSDA 313
            .::.|:||:...:.|:|.||.|.|.|||..:|  || .|.|..:...|||.|||.|::.::..:.
  Fly   329 PNELLTAGQPMPIRCESWGSYPAAKITWLLDGEPIRNAEVTVHSDKEDGNITTSILTLKVTSEND 393

  Fly   314 GKYLSCKAYNHAVPSEPLEDGWKLDIQYVPEAYVRLGTSLDPS---TLREGTDVYFDCLVMAHPN 375
            ...|:|:|.|.......:||...:.:.|.|...|.|... |||   |..||.:|.|.|...|.|.
  Fly   394 NAELTCRATNPWFSGGAIEDKRIIRVAYPPTVSVHLANE-DPSRLVTRAEGQNVTFKCRADARPP 457

  Fly   376 VFRIEWRHNEQPLSHNISLGVIISNHSLVLQGVT---RATAGNYSCVGFNAEGEGISAPFALNIL 437
            |....|..|          |:.:|..|..:..:|   |.:||.|:|...|.|||..|:...|.:.
  Fly   458 VTSYSWFKN----------GMRMSGESTEIMHLTQLERESAGAYACGATNTEGETRSSSLTLKVQ 512

  Fly   438 YAPTCAQNQKKV-YGIAKQEDAKVMCTVDANPRE-VEFSWTFNNSAESIDVATNHIIRSGTTSIV 500
            ::|.|....::. .|........|.|.|||:|.: |.||||:||:.....|..:.|..:|..|.|
  Fly   513 FSPRCKSGTEQTSIGAVSLHSILVKCEVDADPPDSVRFSWTYNNTRNVSPVLNSRIQSNGLASTV 577

  Fly   501 TYTPITELDYGTLLCLASNKIGKQRVPCVFHIIAAGRPEKVHNCTVNNISMTSLTVTCSDGFNGG 565
            ||.|.|:.:..||.|.|||.:|:|..||:.||:.|..||....|.:.|  .|.|.|.|..|.:||
  Fly   578 TYLPQTDSELITLACWASNAVGRQTTPCLVHILPANTPEAPKACELRN--DTVLEVVCVAGSDGG 640

  Fly   566 LPQSFNLELL----------------------------DSYTQEIKANITS--------TIPKFT 594
            |.|.|.||::                            |:....:....||        ..|:|.
  Fly   641 LSQYFMLEVVGGDPLYSGDPGGSAGQGRGQFSEAIGLGDNEISTLNDQATSAPIFRMQENSPQFR 705

  Fly   595 VPGLSPGSIYRLNIYAFNTKGRSDPAIV-----NAAMLRMPEKQLTSEQ------THN------- 641
            :..|.||..|:..:||.|.||||:|.:|     .||.|...::.:.||.      ||:       
  Fly   706 LNNLEPGREYQFLVYAVNAKGRSEPPVVIENVRVAAQLGPYDESILSEDPTPAETTHHGGGGVGG 770

  Fly   642 --------LRAELLFSPVMSLTIGLTLAVL----VAVLAIILA-LRIPCTASSRRRQKELSNENI 693
                    ..|.....|....|:.:..||:    |.|.:||:| :.:.|    |.|.:....:.:
  Fly   771 SGSSSGLGTGASTGSGPEKQSTLLILAAVVVIGAVVVTSIIVAGIVVVC----RHRPRPPEPQEV 831

  Fly   694 SRDESPGPSDKSSGSKEVDDCDEKNPDVVPESIEPDEQAESIRKRQQISTIDTNRSPNRGIFVNE 758
            .:...|..:|..|...|.|:.:|..        |...:|..||.|.        ..||       
  Fly   832 RKSMRPARNDVPSMYIEEDELNELE--------EGGGRAADIRARV--------APPN------- 873

  Fly   759 QQHLTAAEISLRASHGIGYCTLRSGMHAQAQSSVGEISINVTPHVY-SNSISQCTLPRQSSQNVW 822
             .||.          |.|...:..|:.:...:.||...    ||.| |.|..|...|..:...: 
  Fly   874 -SHLC----------GGGGMPMPGGVGSSGGAIVGVAG----PHHYISESFIQYAQPSLNGDVL- 922

  Fly   823 NNYNCNITGARPTSTFHQLTFPQGRVNVGGHNPAQPLHGHAPSPSQASNSSMASSTNTLPQ---- 883
              ....:|.::|.||                                 ||:::|....:||    
  Fly   923 --LPLLVTSSQPCST---------------------------------NSTISSVVLAMPQAKLC 952

  Fly   884 PHPHGRTIA 892
            |.|..|..|
  Fly   953 PDPASRNTA 961

Known Domains:


GeneSequenceDomainRegion External IDIdentity
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 38/105 (36%)
V-set 32..134 CDD:284989 38/105 (36%)
IGc2 160..>214 CDD:197706 18/57 (32%)
Ig 262..328 CDD:299845 25/69 (36%)
IG_like 264..323 CDD:214653 24/62 (39%)
IGc2 360..425 CDD:197706 21/68 (31%)
Ig_3 456..519 CDD:290638 27/64 (42%)
FN3 538..620 CDD:238020 33/118 (28%)
FAM176 643..741 CDD:291517 24/103 (23%)
sideNP_001247334.1 V-set 95..211 CDD:284989 39/116 (34%)
IG_like 100..211 CDD:214653 38/111 (34%)
Ig 235..301 CDD:299845 22/67 (33%)
Ig 326..408 CDD:299845 28/82 (34%)
IG_like 329..407 CDD:214653 28/78 (36%)
IG_like 435..511 CDD:214653 27/86 (31%)
Ig_2 442..511 CDD:290606 25/79 (32%)
FN3 <700..735 CDD:238020 15/35 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130793559
eggNOG 1 0.900 E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23278
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.