DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: side-VII and side-IV

Sequence 1:NP_001262432.1 Gene:side-VII FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_001034052.2 Gene:side-IV FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster

Alignment Length:981 Identity:323/982 (33%)
Similarity:490/982 (50%) Gaps:155/982 (16%)


  Fly     3 LLLLFMLALQLIESSIGSKD---------VPIHQIESIVGENIYLPCNVTTYDGDEPV-LVLWYR 57
            |.||.:..:..:.|:...:|         ||:..::.::|....|||:::..:.|:.| :|||:|
  Fly    47 LPLLMLSGISQVCSTYVEQDELMQNLDRPVPLTTVQGVLGRQAMLPCDISPQERDDAVYMVLWFR 111

  Fly    58 DDKGTPIYSIDIRAGVSKAPKRWSDDSVFGDRAYFIFDKEPGKLSIQNTQASDSGTYRCRVDFLK 122
            :..|.|||:.|:|.......:.||..:.||.||:|.....|.:|.|.|.:..|.|.|||||||..
  Fly   112 EGDGEPIYNFDVRGRQFGQARLWSSPTAFGTRAHFSSTTHPAQLKIDNIRIEDEGVYRCRVDFRN 176

  Fly   123 AQTINSRIRLNVISPPKQVIIRDSSNVERSTVVGPYSEGDIVSLKCQVIGGYPTPTISWYRDGIE 187
            :.|.|.:|.|.||.||.:.:|...:..|::..|..:|||:.:.|.|:|.||.|.|.::||.|...
  Fly   177 SPTRNLKINLTVIVPPDRPVIYGQNRHEKAGNVESFSEGNDIVLSCEVSGGRPRPNVTWYLDNTA 241

  Fly   188 IPCELSHLAGGKIIECEITLPSLGREDLNSRLTCRALSHPRAPIVEAVVQIDMNFAPLNIRLLGA 252
            |.........||.|. .::.|::||:.|||||.|.|.:....|....||.:|:|..|:.:.:|..
  Fly   242 IDESFEQRPDGKTIN-HLSYPNVGRQHLNSRLMCVASNTNLTPPNNRVVILDVNLKPIAVHILTK 305

  Fly   253 HQPLSAGRRYDLLCQSAGSRPPAVITWWQNGIRLEKTTETTSSDGNQTTSTLSISLSKSDAGKYL 317
            .:.:||.|.||:.|:|:||:|||:||||:...:|:|.|:..:...||:.|.|:.:..:.|.||||
  Fly   306 DRFVSADRTYDVECKSSGSKPPALITWWKGSKQLKKLTKNFNEPDNQSLSILTFTPGREDDGKYL 370

  Fly   318 SCKAYNHAVPSEPLEDGWKLDIQYVPEAYVRLGTSLDPSTLREGTDVYFDCLVMAHPNVFRIEWR 382
            :|:|.|..:....:||.|:|.:.|.|...:::|:||:|..::||.|.||:|:|:|:|..:::.|.
  Fly   371 TCRAENQFIDGSAIEDKWRLIVHYQPTTTLKIGSSLNPDDIKEGDDAYFECIVLANPKPYKMSWF 435

  Fly   383 HNEQPLSHNISLGVIISNHSLVLQGVTRATAGNYSCVGFNAEGEGISAPFALNILYAPTCAQNQK 447
            ||.:.|.||||.|||:|:.|||||.|:||:||:|:|:..|:||:|.|.|..|.|.|||.||.:.:
  Fly   436 HNGKELQHNISAGVILSDQSLVLQSVSRASAGDYTCLAVNSEGKGPSNPVTLRIRYAPICATDHE 500

  Fly   448 KVYGIAKQEDAKVMCTVDANPREVEFSWTFNNSAESIDV-ATNHIIRSGTTSIVTYTPITELDYG 511
            ::.|..|.|...:.|.||::|....|.||||:|.|..:: |..|...:| .|.:.|||.|:||||
  Fly   501 ELLGALKHETLPLKCEVDSSPPADSFQWTFNSSGEQTELPARLHSSETG-MSRLNYTPSTDLDYG 564

  Fly   512 TLLCLASNKIGKQRVPCVFHIIAAGRPEKVHNCTVNNISMTSLTVTCSDGFNGGLPQSFNLELLD 576
            |:.|.|.|.||.|:.||||.|:|||||..:.||:|.|.|:.||.|.|.:||:|||||.|.|||::
  Fly   565 TISCWAKNSIGTQKSPCVFQIVAAGRPFPLQNCSVTNQSVDSLQVDCLEGFDGGLPQGFMLELVE 629

  Fly   577 SYTQEIKANIT--STIPKFTVPGLSPGSIYRLNIYAFNTKGRSDPAIVNAAMLRMPEKQLTSEQT 639
            ..|..:..|||  .|...|.:..|...:.||:.|:|.|.||||:|.|::....:...| .|...|
  Fly   630 LNTLRLARNITVSHTPVTFVIDNLDQAATYRMVIFAVNAKGRSEPTIIDDINFKGVAK-FTGAST 693

  Fly   640 HNLRAELLFSPVMSLTIGLTL--AVLVAVLAIILALRIPCTASSRRRQKELSNENISRDE----- 697
            .      |..|:.....||||  .:|.|:..|:||      |..||.....|:.|:...:     
  Fly   694 G------LSMPLSPFLAGLTLFCGLLFAIFCIMLA------AIYRRISNRRSDSNLKVAKHTQLT 746

  Fly   698 ----------SPGPSDKSSGSKE---------------VD------------------------- 712
                      .||.....||:.:               ||                         
  Fly   747 IPADCQLDPLHPGVQTDGSGNHQPHHSLLPLNCDGRNAVDCGALGDVGGGGVGVGLDGGIKGSSP 811

  Fly   713 --------------------------DCDEKNPDVVPESIEPDEQAESIRKRQQISTIDTN--RS 749
                                      |.|:.:|||:|...|         ||...|.:...  .|
  Fly   812 IGLVAMPGDTLRSNARNRHSPMADQADIDDTDPDVIPNQYE---------KRPLKSLVSPPGFAS 867

  Fly   750 PNRGIFVNEQQHLTAAEISLRASH-GIGYCTLRSGMHAQAQSSVGEISIN---VTPHVY--SNSI 808
            |:..:.  ::.:|...|::...|. |:|        .|:..||:|.:|.:   |..:.:  |..|
  Fly   868 PSNRLM--QRDYLRETELTKGGSDVGMG--------AAEGLSSIGLMSSSGNEVLHYTFRPSKQI 922

  Fly   809 SQCTLPRQ---SSQNVWNNYNCNITGARPTSTFHQLTFPQGRVNVGGHNPAQPLHGHAPSPSQAS 870
            |..||.::   :......:.|.:::.:.|||::| ||             .||:.....||:..|
  Fly   923 SYATLNKKGITTCSPPLGSLNYSVSTSTPTSSYH-LT-------------PQPMEVSLLSPNNPS 973

  Fly   871 NSSMAS 876
            .:|..|
  Fly   974 VTSSLS 979

Known Domains:


GeneSequenceDomainRegion External IDIdentity
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 40/103 (39%)
V-set 32..134 CDD:284989 40/103 (39%)
IGc2 160..>214 CDD:197706 19/54 (35%)
Ig 262..328 CDD:299845 28/66 (42%)
IG_like 264..323 CDD:214653 25/59 (42%)
IGc2 360..425 CDD:197706 35/65 (54%)
Ig_3 456..519 CDD:290638 27/64 (42%)
FN3 538..620 CDD:238020 38/84 (45%)
FAM176 643..741 CDD:291517 31/181 (17%)
side-IVNP_001034052.2 V-set 79..188 CDD:284989 40/109 (37%)
IG_like 80..188 CDD:214653 40/108 (37%)
Ig 210..281 CDD:299845 27/72 (38%)
Ig 319..392 CDD:299845 30/73 (41%)
IG_like 319..383 CDD:214653 26/64 (41%)
IG_like 412..489 CDD:214653 40/77 (52%)
IGc2 413..478 CDD:197706 35/65 (54%)
Ig_3 509..572 CDD:290638 27/64 (42%)
fn3 593..675 CDD:278470 37/82 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130793518
eggNOG 1 0.900 E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23278
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.