DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: side-VII and Gm1123

Sequence 1:NP_001262432.1 Gene:side-VII FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_001074245.1 Gene:Gm1123 MGIID:2685969 Length:390 Species:Mus musculus

Alignment Length:176 Identity:51/177 (29%)
Similarity:74/177 (42%) Gaps:51/177 (29%)


  Fly    18 IGSKDV--PIHQIESIVGENIYLPCNVTTYDGDE-PVLVLWYR--------DDKGTPIYSIDIRA 71
            |||..:  |...||...||.::|||..|....|: |:.:.|.|        .|....:||.|   
Mouse   142 IGSVSITTPEQTIEKDQGETVHLPCMFTFISKDQGPLNIEWLRLSGPNNEAMDHVVILYSAD--- 203

  Fly    72 GVSKAPKRWSDDSVFGD---RAYFIF-DKEPG--KLSIQNTQASDSGTYRCRVDFLKAQTINSRI 130
                   :..|| |:.|   |.||.. |.:.|  .::|.|.|.||:|||:|:|..... |:|..:
Mouse   204 -------KIHDD-VYPDLKGRVYFTSNDIKSGDASINITNVQLSDAGTYQCKVKTYPG-TVNRNL 259

  Fly   131 RLNV--------ISPPKQVIIRDSSNVERSTVVGPYSEGDIVSLKC 168
            :|.|        |:.|:|.|.:              :.|:.|.|.|
Mouse   260 QLAVTDHIGSVSITTPEQTIQK--------------ARGETVHLPC 291

Known Domains:


GeneSequenceDomainRegion External IDIdentity
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 36/117 (31%)
V-set 32..134 CDD:284989 36/117 (31%)
IGc2 160..>214 CDD:197706 4/10 (40%)
Ig 262..328 CDD:299845
IG_like 264..323 CDD:214653
IGc2 360..425 CDD:197706
Ig_3 456..519 CDD:290638
FN3 538..620 CDD:238020
FAM176 643..741 CDD:291517
Gm1123NP_001074245.1 V-set 24..139 CDD:284989
IG_like 25..138 CDD:214653
V-set 149..264 CDD:284989 40/127 (31%)
IG_like 152..263 CDD:214653 38/123 (31%)
V-set 274..389 CDD:284989 7/33 (21%)
IG_like 277..388 CDD:214653 6/30 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.