DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: side-VII and side-II

Sequence 1:NP_001262432.1 Gene:side-VII FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_001014485.3 Gene:side-II FlyBaseID:FBgn0259213 Length:1064 Species:Drosophila melanogaster

Alignment Length:992 Identity:314/993 (32%)
Similarity:471/993 (47%) Gaps:149/993 (15%)


  Fly    18 IGSKD--VPIHQIESIVGENIYLPCNVTTYDGDEPV----LVLWYRDDKGTPIYSIDIRAGVSK- 75
            |.|||  |....|:::.|:::.|||.:|     ||:    :|||:||:.|.|:||.|:|...|: 
  Fly    45 ISSKDSHVKTKDIDAVEGKSVSLPCPIT-----EPLDNVYMVLWFRDNAGIPLYSFDVRDKESRE 104

  Fly    76 APKRWSDDSVFGDRAYFIFDKEPGKLSIQNTQASDSGTYRCRVDFLKAQTINSRIRLNVISPPKQ 140
            .|:.||...|||.||.|.||.:|..|.|:.   .|.|.|||||||..:||.:.|..|:||..|:|
  Fly   105 QPRHWSAPEVFGSRAKFHFDSQPATLEIKR---HDQGIYRCRVDFRTSQTQSFRFNLSVIILPEQ 166

  Fly   141 VIIRDSSNVE-RSTVVGPYSEGDIVSLKCQVIGGYPTPTISWYRDGIEIPCELSHLAGGKIIECE 204
            .||.|....: ..|.:||..|||.:.:.|:|:||.|.|.:.|..:|:.:..:..| ..|.:||..
  Fly   167 PIIMDRWGRQLNGTQLGPKQEGDDIVITCRVVGGRPQPQVRWLVNGLLVDNQNEH-NSGDVIENR 230

  Fly   205 ITLPSLGREDLNSRLTCRALSHPRAPIVEAVVQIDMNFAPLNIRLLGAHQPLSAGRRYDLLCQSA 269
            :..||:.|.||||..||:||:.......|....:||:..||.:::|.....:.|.|||::.|:|:
  Fly   231 LLWPSVQRNDLNSVFTCQALNTQLDKPKEKSFILDMHLKPLVVKILEPPSSMIADRRYEVSCESS 295

  Fly   270 GSRPPAVITWWQNGIRLEKTTETTSSDGNQTTSTLSISLSKSDAGKYLSCKAYNHAVPSEPLEDG 334
            ||||.|:|||::...:|.:|.:..|.  |.|.|.||...:..|.||.::|:|.|..|....||..
  Fly   296 GSRPNAIITWYKGKRQLRRTKDDISK--NSTRSELSFVPTTDDDGKSITCRAENPNVNGLYLETM 358

  Fly   335 WKLDIQYVPEAYVRLGTSLDPSTLREGTDVYFDCLVMAHPNVFRIEWRHNEQPLSHNISLGVIIS 399
            |||::.|.|...:|||::|.|..::||.||||:|.|.::|...::.|.||...|.||.|..||.|
  Fly   359 WKLNVVYPPLVTLRLGSTLTPDDIKEGDDVYFECHVQSNPQWRKLLWLHNGIHLEHNTSARVIRS 423

  Fly   400 NHSLVLQGVTRATAGNYSCVGFNAEGEGISAPFALNILYAPTCAQNQKKV-YGIAKQEDAKVMCT 463
            |.|||||.:|:..||||:|...|.|||.:|....|.:.|.|.|....:.: .|.:|.|..:|:|.
  Fly   424 NQSLVLQKITKHYAGNYACSAINDEGETVSNQLPLRVKYTPMCKHADRVILIGASKDETVEVVCE 488

  Fly   464 VDANPREVEFSWTFNNSAESIDVATNHIIRSGTTSIVTYTPITELDYGTLLCLASNKIGKQRVPC 528
            :.|:|....|.|.||||.|::||.:.....:|:.||:.|||:|:.|||||.|.|||::|.|:.||
  Fly   489 IQADPPPRTFRWKFNNSGETLDVGSERFSVNGSRSILKYTPVTDQDYGTLSCWASNEVGTQQHPC 553

  Fly   529 VFHIIAAGRPEKVHNCTVNNISMTSLTVTCSDGFNGGLPQSFNLELLDSYTQEIKANITS----- 588
            :|.::.|..|..|.||||.|.:..|:.:.|..|::|||||.|.||:..:.|...:.|:::     
  Fly   554 LFQVVLAALPNAVSNCTVFNRTELSVDIQCIPGYDGGLPQIFVLEMFSTRTGITRFNLSNAEEAL 618

  Fly   589 ----TIPKFTVPGLSPGSIYRLNIYAFNTKGRSDPAIVNAAMLRMPEKQLTSEQTHNLRAELLFS 649
                .:...|...:...:..||.||::|.||||...::...::.....:...:.|      |..|
  Fly   619 FSLENLDTLTSMMVQENNSLRLRIYSYNQKGRSAAYLLTDFIIGSTAYKTDDDVT------LTLS 677

  Fly   650 PVMSLTIGLTLAVLVAVLAIILALRIPCTASSRRRQKELSNENISRDESPGPSDKSSG------- 707
            ||:   :|..|.:::..:||.:.:.:.....:.||.:...::..:...:..|||...|       
  Fly   678 PVI---VGSVLTIIIIGVAIAIRIFVVTFVHNLRRNRHHGSKATAAGVTAQPSDVFKGGNLEKPR 739

  Fly   708 -------SKEVDDC--DEKNPDVVPESIEPDEQAESIRKRQQISTID-------TNRSPNRGIFV 756
                   :|..:|.  ||::|||:|........|.|  .....|.:.       |..|.:..:..
  Fly   740 WQHTDIKTKSSEDLVEDERDPDVIPSQYVGGSSAGS--SGSNASNVGSTTAGTATGSSTSTAVVA 802

  Fly   757 NEQQHLTA------AEISLRASHGIGYC--TLRSGMHAQAQSSVGEISINVTPHVYSNSISQCTL 813
            |.....:|      |..|..|:.|..:.  |..:|..|...|..|    |||..:.:......|:
  Fly   803 NANAAASAMAGPGGATSSASATDGHQFASGTAAAGGGASKWSPNG----NVTTTMLTGDAVNATV 863

  Fly   814 PRQSSQNVWNNYN----------------CNITGARPTST-FHQLTFPQGR-------VNVGGHN 854
                   .:|..|                |:.|...|:|: ...|..|.|.       :.|||..
  Fly   864 -------TYNQINAQRAQLLAAVAAVGGGCSSTVISPSSSILGGLGKPLGMGMGMGLGMGVGGTV 921

  Fly   855 PAQPLHGHAPSPSQASNSSMA--------SSTNTLPQ------------------PHP------- 886
            ...|       .|.:|.:::|        |...|||.                  .||       
  Fly   922 IGSP-------TSLSSTATLAAHLQPAHSSGVGTLPPGLGSGGGYILNAYASGRLHHPPGGGVPG 979

  Fly   887 ---HGRTIAMHHMNQAQ 900
               |..|:..||..|.|
  Fly   980 GATHTATLNRHHHQQQQ 996

Known Domains:


GeneSequenceDomainRegion External IDIdentity
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 46/107 (43%)
V-set 32..134 CDD:284989 46/107 (43%)
IGc2 160..>214 CDD:197706 18/54 (33%)
Ig 262..328 CDD:299845 26/66 (39%)
IG_like 264..323 CDD:214653 23/59 (39%)
IGc2 360..425 CDD:197706 33/65 (51%)
Ig_3 456..519 CDD:290638 29/63 (46%)
FN3 538..620 CDD:238020 30/91 (33%)
FAM176 643..741 CDD:291517 24/114 (21%)
side-IINP_001014485.3 IG_like 55..160 CDD:214653 47/113 (42%)
Ig 57..160 CDD:299845 47/111 (42%)
Ig 188..251 CDD:299845 25/64 (39%)
Ig 289..363 CDD:299845 30/76 (39%)
IG_like 289..351 CDD:214653 25/64 (39%)
Ig_2 376..460 CDD:290606 39/84 (46%)
IG_like 383..454 CDD:214653 36/71 (51%)
Ig 470..548 CDD:299845 33/78 (42%)
IG_like 481..557 CDD:214653 35/76 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130793606
eggNOG 1 0.900 E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23278
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.