DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: side-VII and Cd276

Sequence 1:NP_001262432.1 Gene:side-VII FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_877976.1 Gene:Cd276 RGDID:727815 Length:316 Species:Rattus norvegicus

Alignment Length:343 Identity:65/344 (19%)
Similarity:126/344 (37%) Gaps:96/344 (28%)


  Fly    19 GSKDVPIHQ--IESIVGENIYLPCNVTTYDGD--EPVLVLWYRDDKGTPIYSIDIRAGVSKAPKR 79
            |:.:|.:.:  :.::|..:..|.|:.:...|.  ..:.::|...|....::|  ...|..:....
  Rat    27 GAVEVQVSEDPVVALVDTDATLRCSFSPEPGFSLRQLNLIWQLTDTKQLVHS--FTEGRDQGSAY 89

  Fly    80 WSDDSVFGDRAYFIFDKEPGKLSIQNTQASDSGTYRCRVDFLKAQTINS-RIRLNVISPPKQVII 143
            .:..::|.|    :..:....|.:|..:.:|.|:|.|   |:..|..:| .:.|.|.:|    ..
  Rat    90 ANRTALFPD----LLVQGNASLRLQRVRVTDEGSYTC---FVSIQDFDSAAVSLQVAAP----YS 143

  Fly   144 RDSSNVERSTVVGPYSEGDIVSLKCQVIGGYPTPTISWYRDGIEIPCELSHLAGGKIIECEITLP 208
            :.|..:|.:..:.|   ||:|::.|....|||...:.| :||..:|                   
  Rat   144 KPSMTLEPNKDLRP---GDMVTITCSSYQGYPEAEVFW-KDGQGLP------------------- 185

  Fly   209 SLGREDLNSRLTCRALSHPRAPI-VEAVVQIDMNFAPLNIRLLGAHQPLSAGRRYDLLCQSA-GS 271
                  |...:|...:::.|... |.:|:::          :|||:...|...|..:|.|.| ||
  Rat   186 ------LTGNVTTSQMANERGLFDVHSVLRV----------VLGANGTYSCLVRNPVLQQDAHGS 234

  Fly   272 ---------RPPAVITWWQNGIRL----------------------EKTTETTSSDGNQTTSTLS 305
                     .||..: |...|:.:                      |:.......||:...|..:
  Rat   235 VTITGQPMTFPPEAL-WVTVGLSVCLVILLVALAFVCWRKIKQSCEEENAGAEDQDGDGEGSKTA 298

  Fly   306 I-----SLSKSDAGKYLS 318
            :     |.:|.|.|:.::
  Rat   299 LRPLKHSENKEDDGQEIA 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 20/105 (19%)
V-set 32..134 CDD:284989 20/105 (19%)
IGc2 160..>214 CDD:197706 11/54 (20%)
Ig 262..328 CDD:299845 17/95 (18%)
IG_like 264..323 CDD:214653 17/93 (18%)
IGc2 360..425 CDD:197706
Ig_3 456..519 CDD:290638
FN3 538..620 CDD:238020
FAM176 643..741 CDD:291517
Cd276NP_877976.1 IG_like 37..138 CDD:214653 20/110 (18%)
Ig 44..139 CDD:299845 20/104 (19%)
ig 151..231 CDD:278476 24/119 (20%)
IG_like 156..238 CDD:214653 27/121 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.