DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: side-VII and SIRPA

Sequence 1:NP_001262432.1 Gene:side-VII FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_001317657.1 Gene:SIRPA HGNCID:9662 Length:508 Species:Homo sapiens

Alignment Length:398 Identity:90/399 (23%)
Similarity:140/399 (35%) Gaps:121/399 (30%)


  Fly     4 LLLFMLALQLIESSI-GSKDVPIHQIESIV----GENIYLPCNVTT---------YDGDEPVLVL 54
            ||..:||.....|.: |.:::.:.|.:..|    ||...|.|..|:         :.|..|...|
Human    14 LLCLLLAASCAWSGVAGEEELQVIQPDKSVLVAAGETATLRCTATSLIPVGPIQWFRGAGPGREL 78

  Fly    55 WYRDDKG-TPIYSIDIRAGVSKAPKRWSDDSVFGDRAYFIFDKEPGKLSIQNTQASDSGTYRCRV 118
            .|...:| .|..:.     ||...||.:.|.               .:.|.|...:|:|||.| |
Human    79 IYNQKEGHFPRVTT-----VSDLTKRNNMDF---------------SIRIGNITPADAGTYYC-V 122

  Fly   119 DFLKAQTINSRIRLNVISPPKQVIIRDSSNVERS--------TVVGPYSEG---DIVSLKCQVIG 172
            .|.|..             |..|..:..:..|.|        .|.||.:..   ..||..|:..|
Human   123 KFRKGS-------------PDDVEFKSGAGTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHG 174

  Fly   173 GYPTP-TISWYRDGIEI------------PCELSHLAGGKIIECEITLPSLGREDLNSRLTCRAL 224
            ..|.. |:.|:::|.|:            ....|..:..|::        |.|||::|::.|.  
Human   175 FSPRDITLKWFKNGNELSDFQTNVDPVGESVSYSIHSTAKVV--------LTREDVHSQVICE-- 229

  Fly   225 SHPRAPIVEAVVQIDMNFAPL--------NIR----LLGAHQPLSAGRRYDLLCQSAGSRPPAV- 276
                      |..:.:...||        .||    |....||:.|..:.::.||.....|..: 
Human   230 ----------VAHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYPQRLQ 284

  Fly   277 ITWWQNG--IRLE-KTTETTSSDGNQT-TSTLSISLSKSDAGKYLSC-----------KAYNHAV 326
            :||.:||  .|.| .:|.|.:.||... .|.|.:::|.......|:|           |:::..|
Human   285 LTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSHDLKV 349

  Fly   327 PSEPLEDG 334
            .:.|.|.|
Human   350 SAHPKEQG 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 27/116 (23%)
V-set 32..134 CDD:284989 27/116 (23%)
IGc2 160..>214 CDD:197706 14/70 (20%)
Ig 262..328 CDD:299845 20/82 (24%)
IG_like 264..323 CDD:214653 19/75 (25%)
IGc2 360..425 CDD:197706
Ig_3 456..519 CDD:290638
FN3 538..620 CDD:238020
FAM176 643..741 CDD:291517
SIRPANP_001317657.1 IgV_SIRP 35..145 CDD:319346 32/144 (22%)
IgC_SIRP_domain_2 147..250 CDD:319314 23/123 (19%)
IgC_SIRP_domain_3 252..355 CDD:319334 25/103 (24%)
SH2-binding. {ECO:0000255} 433..436
SH3-binding. {ECO:0000255} 443..448
SH2-binding. {ECO:0000255} 457..460
SH2-binding. {ECO:0000255} 474..477
SH2-binding. {ECO:0000255} 500..503
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.