DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: side-VII and nphs1

Sequence 1:NP_001262432.1 Gene:side-VII FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster
Sequence 2:XP_017944912.1 Gene:nphs1 XenbaseID:XB-GENE-487811 Length:1095 Species:Xenopus tropicalis

Alignment Length:790 Identity:143/791 (18%)
Similarity:260/791 (33%) Gaps:295/791 (37%)


  Fly     5 LLFMLALQLIESSIGSKDVPIHQIESI-VGENIYLPCNVTTYDGDEPVLVLWYRDDKGTPIYSID 68
            :||.....:||..||         .|: .||.:.|.|  .:..|:....:.|.::|        |
 Frog   228 VLFPPNAPIIEGYIG---------PSVKAGETLKLIC--ISLSGNPLATLQWSKND--------D 273

  Fly    69 IRAGVSKAPKRW-SDDSVFGDRAYFIFDKEPGKLSIQNTQASDSGTYRCR-VDFLKAQTINSRIR 131
            :      ...|| :|:.|...|::...:.:|         |.:.....|. |:.:..:|:.:.|.
 Frog   274 V------VSTRWETDEVVRASRSHLTLNIKP---------ADNMAVVSCEAVNHVTPETLKTSII 323

  Fly   132 LNVISPPKQV-IIRDSSNVERSTV------------------VGP-------------------- 157
            |||:..|.:| |:..||..|:|.:                  :||                    
 Frog   324 LNVVFLPTEVTILGSSSGPEKSNLTFSCFTAASNPPVQIRWWLGPKELVNTIVTISDAVHGGKVT 388

  Fly   158 -------------------------------------------------------YSEGDIVSLK 167
                                                                   :..|..|.:.
 Frog   389 MSNLTMEALREEHGMALTCEAFNEAILYTKSNSVTLSVQYPPQNVWIEAPPADKFFRAGTSVKMT 453

  Fly   168 CQVIGGYPTPTISWYRDGIEIPCELSHLAGGKIIECEITLPSLGREDLNSRLTCRALSHPRAPIV 232
            |...||.|.|.::|.:|...:... |.:..|||:..|||:.::..::: :...|.|.:..:.|.:
 Frog   454 CFSSGGNPPPRLTWIKDTKSLSGG-SQIHSGKIVTKEITIITVPSDNM-ATYRCNASNIGKTPAL 516

  Fly   233 EAVVQIDMNFAPLNIRLLGAHQPLSAGRRYDLLCQSAGSRPPAVITWWQNGIRLEKT---TETTS 294
            .|..::.:.|..:::.::.:.:....|....|.|.:..|.|.:.|:|.::|.:|:..   .:.:.
 Frog   517 TASTKLKVQFPAIDVNIISSAKEYRRGSTIILTCVTGSSNPASTISWVKDGEQLKAQDLGRKPSL 581

  Fly   295 SDGNQTTSTLSISLSKSDAGKYLSCKAYNHAVPSEPLEDGWKLDIQYVPE---------AYVRLG 350
            ..|..::|.:::..:..|.|:.:||:|:: :|.:|.:...:||:|.:.||         ..|..|
 Frog   582 YGGISSSSRVTLKAASKDNGRRVSCEAFS-SVLNEAVNTFYKLNILFPPEFLDDQPAVVQAVEHG 645

  Fly   351 TSLDPSTLREGTDVYFDCLVMAHPNVFRIEW-------------RHNEQPLSHNISLGVIISNHS 402
            .:|.|..:|            |:|......|             ||:            :....:
 Frog   646 AALIPVRVR------------ANPPQINYTWSLWGEKLIRDGAYRHH------------LRGEGA 686

  Fly   403 LVLQGVTRATAGNYSCVGFNAEGEGISAPFALNILYAPTCAQNQKKVYGIAKQE-----DAKVMC 462
            |.:..|:||.:|.|:....|.||:. |....|::.|:||       :..:...|     ||::.|
 Frog   687 LEIWNVSRADSGVYNVTCVNKEGKN-SIVIRLDVQYSPT-------IRSLGDTEVDLGSDAEIAC 743

  Fly   463 TVDANPR---------------------------------------------------------- 469
            |.||||.                                                          
 Frog   744 TADANPATDSMFQWRWLVWIRLYCSVIITIRPYVGFQLKGLFYQCECKALQWIQNGAYLDVVKPD 808

  Fly   470 ------------------------------EVEFSWTFNNSAESIDV-------ATNHIIRSGTT 497
                                          .|.|||..|  ..|:|:       .|.|.:...|:
 Frog   809 IHKGVHLSKVAVPGDGKSVAALVCKAEGIPSVAFSWAKN--GVSLDLKDPRYSEKTFHELSVHTS 871

  Fly   498 SIVTYTPITELDYGTLLCLASNKIGKQRVPCVFHIIAAGRPEKVHNCTVNNISMTSLTVTCSDGF 562
            ::|........||....|.|:|.:|....  ...:::..||:......|...:...:|:..|.||
 Frog   872 TLVISNVSAVKDYALFTCTATNTLGVDSF--TIQLVSPSRPDPPSGLRVIGFTHNWVTLQWSAGF 934

  Fly   563 NGGLPQSFNL 572
            :||..|.|.:
 Frog   935 DGGAEQKFRV 944

Known Domains:


GeneSequenceDomainRegion External IDIdentity
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 21/104 (20%)
V-set 32..134 CDD:284989 21/104 (20%)
IGc2 160..>214 CDD:197706 16/54 (30%)
Ig 262..328 CDD:299845 16/69 (23%)
IG_like 264..323 CDD:214653 15/62 (24%)
IGc2 360..425 CDD:197706 13/78 (17%)
Ig_3 456..519 CDD:290638 24/163 (15%)
FN3 538..620 CDD:238020 10/36 (28%)
FAM176 643..741 CDD:291517
nphs1XP_017944912.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3515
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.