DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: FoxP and FOXP2

Sequence 1:NP_001247011.1 Gene:FoxP FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_683696.2 Gene:FOXP2 HGNCID:13875 Length:740 Species:Homo sapiens

Alignment Length:371 Identity:159/372 (43%)
Similarity:202/372 (54%) Gaps:75/372 (20%)


  Fly   142 SYMHDEFAMRKYYHPLFAHGICRWPGCEMDLEDITSFVKHLNTEHGLDDRSTAQARVQMQVVSQL 206
            |..|:|....   |.|:.||:|:|||||...||...|:||||.||.||||||||.|||||||.||
Human   355 SSSHEETGAS---HTLYGHGVCKWPGCESICEDFGQFLKHLNNEHALDDRSTAQCRVQMQVVQQL 416

  Fly   207 ESHLQKERDRLQAMMHHLYLSK----------QLLSPTKIDRKDVPGREGKFCRSPLTVNSIGRP 261
            |..|.|||:||||||.||::..          .|:|...:.:..:........::|.|..:...|
Human   417 EIQLSKERERLQAMMTHLHMRPSEPKPSPKPLNLVSSVTMSKNMLETSPQSLPQTPTTPTAPVTP 481

  Fly   262 IRQTNSPS---PLNLPMVNSTNLCSIKKRNHDKNTFSINGGLPYMLERAGLDVQQEIHRNREFYK 323
            |  |..||   |.::|     |:.:|::|:.||               ..:.:..||..|.||||
Human   482 I--TQGPSVITPASVP-----NVGAIRRRHSDK---------------YNIPMSSEIAPNYEFYK 524

  Fly   324 NADVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRTNLSLHKCFVR 388
            |||||||||||:||||||::|.|:||||||||:||..||.||||||||||||:|.||||||||||
Human   525 NADVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHKCFVR 589

  Fly   389 YEDDFGSFWMVDDNEFVKRRHLSRGRPRKYEPSSSPNSCQSGNGVPT-DKN-PCDNCTQHCTSLP 451
            .|:..|:.|.||:.|:.|||                  .|...|.|| .|| |        |||.
Human   590 VENVKGAVWTVDEVEYQKRR------------------SQKITGSPTLVKNIP--------TSLG 628

  Fly   452 PGADNPLDSNNPNDLGRIGCLPYCGSDGLSKASKDYSNMDSGMIES 497
            .||  .|:::....|.. ..||...:.||      .:|..||::::
Human   629 YGA--ALNASLQAALAE-SSLPLLSNPGL------INNASSGLLQA 665

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777 47/67 (70%)
FH 328..400 CDD:238016 54/72 (75%)
FOXP2NP_683696.2 FOXP-CC 367..434 CDD:292777 47/67 (70%)
FH 529..601 CDD:238016 54/72 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4385
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4184
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001061
OrthoInspector 1 1.000 T608287
orthoMCL 1 0.900 OOG5_129522
Panther 1 1.100 O PTHR45796
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.720

Return to query results.
Submit another query.