DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: FoxP and Foxp4

Sequence 1:NP_001247011.1 Gene:FoxP FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_017173175.1 Gene:Foxp4 MGIID:1921373 Length:692 Species:Mus musculus

Alignment Length:371 Identity:162/372 (44%)
Similarity:201/372 (54%) Gaps:68/372 (18%)


  Fly   155 HPLFAHGICRWPGCEMDLEDITSFVKHLNTEHGLDDRSTAQARVQMQVVSQLESHLQKERDRLQA 219
            |||:.||.|:|||||...||:..|:|||||||.||||||||.|||||||.|||..|.||.:||||
Mouse   307 HPLYGHGECKWPGCETLCEDLGQFIKHLNTEHALDDRSTAQCRVQMQVVQQLEIQLAKESERLQA 371

  Fly   220 MMHHLYLS-------KQLLSPTKIDRKDVPGREGKFCRSPLTVNSIGRPIRQTNSP-------SP 270
            ||.||::.       .|...|.......||| ...|  |.:||::...|....:.|       :|
Mouse   372 MMAHLHMRPSEPKPFSQPHLPHCSQLNPVPG-SSSF--SKVTVSADPFPDGLVHPPTSAAAPVTP 433

  Fly   271 LNLPMVNSTNLCS---IKKRNHDKNTFSINGGLPYMLERAGLDVQQEIHRNREFYKNADVRPPFT 332
            |..|.:.|.:|.|   .::|::||....|:               .|:.:|.|||||||||||||
Mouse   434 LRPPGLGSASLHSGGPARRRSNDKFCSPIS---------------SELAQNHEFYKNADVRPPFT 483

  Fly   333 YASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRTNLSLHKCFVRYEDDFGSFW 397
            |||||||||:::||:|||||||||||...|.|||||.||||||:|.||||||||||.|:..|:.|
Mouse   484 YASLIRQAILETPDRQLTLNEIYNWFTRMFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVW 548

  Fly   398 MVDDNEFVKRRHLSRGRPRKYEPS-----------------SSPNSCQSGNGVPTDKNPCDNCTQ 445
            .||:.|:.||      ||.|...|                 :|..:..:.:..|...||      
Mouse   549 TVDEREYQKR------RPPKMTGSPTLVKNMISGLSYGALNASYQAALAESSFPLLSNP------ 601

  Fly   446 HCTSLPPGADNPLDSNNPNDLGRIG-CLPYCGSDGLSKAS-KDYSN 489
              ..|.||:.:.|...:..|||..| .||..||....:.| ..||:
Mouse   602 --GMLNPGSASSLLPLSQEDLGVPGEPLPSNGSSSPPRLSPPQYSH 645

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777 47/67 (70%)
FH 328..400 CDD:238016 54/72 (75%)
Foxp4XP_017173175.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4385
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001061
OrthoInspector 1 1.000 T615126
orthoMCL 1 0.900 OOG5_129522
Panther 1 1.100 O PTHR45796
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4064
TreeFam 1 0.960
87.800

Return to query results.
Submit another query.