DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: FoxP and foxp3a

Sequence 1:NP_001247011.1 Gene:FoxP FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001316496.1 Gene:foxp3a ZFINID:ZDB-GENE-061116-2 Length:419 Species:Danio rerio

Alignment Length:278 Identity:105/279 (38%)
Similarity:137/279 (49%) Gaps:71/279 (25%)


  Fly   155 HP-------LFAHGICRWPGCEMDLEDITS----FVKHLNTEHGLDDRSTAQARVQMQVVSQLES 208
            ||       |...|.||||||... ||:.:    |::||:|:|...|||..|.|:|...|..:|:
Zfish   159 HPYSLSGDYLCVKGQCRWPGCSKS-EDVFTEYGHFLRHLSTDHAPGDRSIGQLRMQKDRVQHMEN 222

  Fly   209 HLQKERDRLQAMMHHLYLSKQLLSPTKIDRKDVPGREGKFCRSPLTVNSIGRPIRQTNSPSPLNL 273
            .|..||.:||||..||           :|.|.. ...|.....|..::.:.:|.           
Zfish   223 QLTAERQKLQAMQLHL-----------LDVKST-SEGGNIVEKPAHLSGLLQPA----------- 264

  Fly   274 PMVNSTNLCSIKKRNHDKNTFSINGGLPYMLERAGLDVQQE-------------IHRNREFYKNA 325
                |:|       :|            |..|||..:...:             |..:.|:||..
Zfish   265 ----SSN-------DH------------YDCERAATEALTQGYWQISTSQVIPGIIPSFEYYKFT 306

  Fly   326 DVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRTNLSLHKCFVRYE 390
            ::||||||||:||.||:.||:|||||.|||.||.:.|.|||.|.||||||:|.||||||||||.|
Zfish   307 NMRPPFTYASMIRWAILKSPEKQLTLKEIYQWFTSMFFYFRHNTATWKNAVRHNLSLHKCFVRVE 371

  Fly   391 DDFGSFWMVDDNEFVKRR 408
            ...||.|.||:.||::|:
Zfish   372 GRKGSVWTVDEEEFLRRK 389

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777 31/71 (44%)
FH 328..400 CDD:238016 51/72 (71%)
foxp3aNP_001316496.1 FOXP-CC 168..238 CDD:318404 31/71 (44%)
Forkhead 309..383 CDD:306709 52/74 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4385
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 193 1.000 Inparanoid score I3766
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45796
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.