DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxP and foxp3a

DIOPT Version :9

Sequence 1:NP_001247011.1 Gene:FoxP / 41182 FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001316496.1 Gene:foxp3a / 571165 ZFINID:ZDB-GENE-061116-2 Length:419 Species:Danio rerio


Alignment Length:278 Identity:105/278 - (37%)
Similarity:137/278 - (49%) Gaps:71/278 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 HP-------LFAHGICRWPGCEMDLEDITS----FVKHLNTEHGLDDRSTAQARVQMQVVSQLES 208
            ||       |...|.||||||... ||:.:    |::||:|:|...|||..|.|:|...|..:|:
Zfish   159 HPYSLSGDYLCVKGQCRWPGCSKS-EDVFTEYGHFLRHLSTDHAPGDRSIGQLRMQKDRVQHMEN 222

  Fly   209 HLQKERDRLQAMMHHLYLSKQLLSPTKIDRKDVPGREGKFCRSPLTVNSIGRPIRQTNSPSPLNL 273
            .|..||.:||||..||           :|.|.. ...|.....|..::.:.:|.           
Zfish   223 QLTAERQKLQAMQLHL-----------LDVKST-SEGGNIVEKPAHLSGLLQPA----------- 264

  Fly   274 PMVNSTNLCSIKKRNHDKNTFSINGGLPYMLERAGLDVQQE-------------IHRNREFYKNA 325
                |:|       :|            |..|||..:...:             |..:.|:||..
Zfish   265 ----SSN-------DH------------YDCERAATEALTQGYWQISTSQVIPGIIPSFEYYKFT 306

  Fly   326 DVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRTNLSLHKCFVRYE 390
            ::||||||||:||.||:.||:|||||.|||.||.:.|.|||.|.||||||:|.||||||||||.|
Zfish   307 NMRPPFTYASMIRWAILKSPEKQLTLKEIYQWFTSMFFYFRHNTATWKNAVRHNLSLHKCFVRVE 371

  Fly   391 DDFGSFWMVDDNEFVKRR 408
            ...||.|.||:.||::|:
Zfish   372 GRKGSVWTVDEEEFLRRK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777 30/70 (43%)
FH 328..400 CDD:238016 50/71 (70%)
foxp3aNP_001316496.1 FOXP-CC 168..238 CDD:318404 30/70 (43%)
Forkhead 309..383 CDD:306709 52/73 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5255
eggNOG 1 0.900 - - E2759_KOG4385
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45796
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.