DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: FoxP and foxp1b

Sequence 1:NP_001247011.1 Gene:FoxP FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_005166112.1 Gene:foxp1b ZFINID:ZDB-GENE-041203-1 Length:676 Species:Danio rerio

Alignment Length:320 Identity:152/321 (47%)
Similarity:186/321 (58%) Gaps:72/321 (22%)


  Fly   155 HPLFAHGICRWPGCEMDLEDITSFVKHLNTEHGLDDRSTAQARVQMQVVSQLESHLQKERDRLQA 219
            |||:.||:|:|||||...||..||:||||.||.||||||||.|||||||.|||..|.|:::||||
Zfish   284 HPLYGHGVCKWPGCEAVFEDFQSFLKHLNNEHALDDRSTAQCRVQMQVVQQLELQLAKDKERLQA 348

  Fly   220 MMHHLYLSKQLLSPTKIDRKDVPGREGKFCRSPLTVNSIGRPIRQTNSPS---PLNLP------- 274
            ||.||::......||                 |..:|.:........:|:   ||:||       
Zfish   349 MMTHLHVKSTEPKPT-----------------PQPLNLVSNVTLSKTAPAASPPLSLPQTPTTPT 396

  Fly   275 -----------MVNSTNLCS---IKKRNHDKNTFSINGGLPYMLERAGLDVQQEIHRNREFYKNA 325
                       ::..|:|.|   |::|..||               ..:.:..:|.:|:|||.||
Zfish   397 APLTPLSQTHSVITPTSLHSVGPIRRRYSDK---------------YNMPISPDIVQNKEFYMNA 446

  Fly   326 DVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRTNLSLHKCFVRYE 390
            :|||||||||||||||::||:||||||||||||...|.||||||||||.|:||||||||||||.|
Zfish   447 EVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKGAVRTNLSLHKCFVRVE 511

  Fly   391 DDFGSFWMVDDNEFVKRRHLSRGRPRKYEPSSSPNSCQSGNGVPTDKNPCDNCTQHCTSL 450
            |||||||.|||.||.:.||:.||||||:               ..|:| ||....|..:|
Zfish   512 DDFGSFWTVDDEEFKRGRHIQRGRPRKH---------------VADEN-CDQLLVHSPAL 555

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777 46/67 (69%)
FH 328..400 CDD:238016 61/72 (85%)
foxp1bXP_005166112.1 FOXP-CC 286..353 CDD:318404 46/67 (69%)
FH 449..521 CDD:238016 61/72 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4385
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001061
OrthoInspector 1 1.000 T595786
orthoMCL 1 0.900 OOG5_129522
Panther 1 1.100 LDO PTHR45796
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4064
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.