DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: FoxP and foxp4

Sequence 1:NP_001247011.1 Gene:FoxP FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_009304271.1 Gene:foxp4 ZFINID:ZDB-GENE-101207-1 Length:702 Species:Danio rerio

Alignment Length:277 Identity:135/278 (49%)
Similarity:170/278 (61%) Gaps:38/278 (14%)


  Fly   145 HDEFAMRKYYHPLFAHGICRWPGCEMDLEDITSFVKHLNTEHGLDDRSTAQARVQMQVVSQLESH 209
            |:|....   |||:.||.|:|||||...||:..|:||||:||.||||||||.|||||||.|||..
Zfish   311 HEEHTAS---HPLYGHGECKWPGCEALCEDMGQFIKHLNSEHALDDRSTAQCRVQMQVVQQLEIQ 372

  Fly   210 LQKERDRLQAMMHHLYLSK----------QLLSPTKIDRKDVPGREGKFCRSPLTVNSIGRPIRQ 264
            |.||.:||||||.||::..          .|.|...:.:::..|........|.:..:...|:||
Zfish   373 LAKESERLQAMMAHLHMRPSEPKHFNQPLNLASSVSLSKRENDGFPEGLPHPPTSAATPITPMRQ 437

  Fly   265 TNSPSPLNLPMVNSTNLCS---IKKRNHDKNTFSINGGLPYMLERAGLDVQQEIHRNREFYKNAD 326
              .||     :::|::|..   |::||.||..               ..:..|:.:|.|||||||
Zfish   438 --GPS-----VISSSSLHGVGPIRRRNSDKFC---------------TPIASELAQNCEFYKNAD 480

  Fly   327 VRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRTNLSLHKCFVRYED 391
            ||||||||||||.||:::||:|||||||||||...|.|||||.||||||:|.||||||||||.|:
Zfish   481 VRPPFTYASLIRHAILEAPDRQLTLNEIYNWFTRMFAYFRRNTATWKNAVRHNLSLHKCFVRVEN 545

  Fly   392 DFGSFWMVDDNEFVKRR 408
            ..|:.|.||:.|:.|||
Zfish   546 VKGAVWTVDEVEYQKRR 562

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777 46/67 (69%)
FH 328..400 CDD:238016 53/72 (74%)
foxp4XP_009304271.1 FOXP-CC 320..387 CDD:292777 46/67 (69%)
Forkhead 482..561 CDD:278670 56/79 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001061
OrthoInspector 1 1.000 T595786
orthoMCL 1 0.900 OOG5_129522
Panther 1 1.100 O PTHR45796
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4064
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.