DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxP and foxp4

DIOPT Version :9

Sequence 1:NP_001247011.1 Gene:FoxP / 41182 FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_009304271.1 Gene:foxp4 / 557245 ZFINID:ZDB-GENE-101207-1 Length:702 Species:Danio rerio


Alignment Length:277 Identity:135/277 - (48%)
Similarity:170/277 - (61%) Gaps:38/277 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 HDEFAMRKYYHPLFAHGICRWPGCEMDLEDITSFVKHLNTEHGLDDRSTAQARVQMQVVSQLESH 209
            |:|....   |||:.||.|:|||||...||:..|:||||:||.||||||||.|||||||.|||..
Zfish   311 HEEHTAS---HPLYGHGECKWPGCEALCEDMGQFIKHLNSEHALDDRSTAQCRVQMQVVQQLEIQ 372

  Fly   210 LQKERDRLQAMMHHLYLSK----------QLLSPTKIDRKDVPGREGKFCRSPLTVNSIGRPIRQ 264
            |.||.:||||||.||::..          .|.|...:.:::..|........|.:..:...|:||
Zfish   373 LAKESERLQAMMAHLHMRPSEPKHFNQPLNLASSVSLSKRENDGFPEGLPHPPTSAATPITPMRQ 437

  Fly   265 TNSPSPLNLPMVNSTNLCS---IKKRNHDKNTFSINGGLPYMLERAGLDVQQEIHRNREFYKNAD 326
              .||     :::|::|..   |::||.||..               ..:..|:.:|.|||||||
Zfish   438 --GPS-----VISSSSLHGVGPIRRRNSDKFC---------------TPIASELAQNCEFYKNAD 480

  Fly   327 VRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRTNLSLHKCFVRYED 391
            ||||||||||||.||:::||:|||||||||||...|.|||||.||||||:|.||||||||||.|:
Zfish   481 VRPPFTYASLIRHAILEAPDRQLTLNEIYNWFTRMFAYFRRNTATWKNAVRHNLSLHKCFVRVEN 545

  Fly   392 DFGSFWMVDDNEFVKRR 408
            ..|:.|.||:.|:.|||
Zfish   546 VKGAVWTVDEVEYQKRR 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777 45/66 (68%)
FH 328..400 CDD:238016 52/71 (73%)
foxp4XP_009304271.1 FOXP-CC 320..387 CDD:292777 45/66 (68%)
Forkhead 482..561 CDD:278670 55/78 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5255
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001519
OrthoInspector 1 1.000 - - otm25338
orthoMCL 1 0.900 - - OOG6_103982
Panther 1 1.100 - - O PTHR45796
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4064
SonicParanoid 1 1.000 - - X957
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.