DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: FoxP and foxp2

Sequence 1:NP_001247011.1 Gene:FoxP FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001025253.1 Gene:foxp2 ZFINID:ZDB-GENE-041203-2 Length:697 Species:Danio rerio

Alignment Length:417 Identity:163/418 (39%)
Similarity:215/418 (51%) Gaps:105/418 (25%)


  Fly   138 NNDFSYMHDEFAMRKYYHPLFAHGICRWPGCEMDLEDITSFVKHLNTEHGLDDRSTAQARVQMQV 202
            |...|.:|:|.|:.   |.|:.||:|:|||||...:|...|:||||.||.||||||||.||||||
Zfish   289 NRRESSLHEETAVS---HSLYGHGVCKWPGCESICDDFGQFLKHLNNEHALDDRSTAQCRVQMQV 350

  Fly   203 VSQLESHLQKERDRLQAMMHHLYL--SKQLLSPTKID-------RKDVPG-REGKFCRSPLTVNS 257
            |.|||..|.|||:||||||.||::  |:...||..::       .|::|. ......::|.|..:
Zfish   351 VQQLEIQLSKERERLQAMMAHLHMRPSEPKPSPKPLNLVSSVTMSKNLPSISPPNLPQTPTTPTA 415

  Fly   258 IGRPIRQ----TNSPSPLNLPMVNSTNLCSIKKRNHDKNTFSINGGLPYMLERAGLDVQQEIHRN 318
            ...|:.|    .|..||.|:|     ::.::::|:.||.:.:::               .||..|
Zfish   416 PVTPLSQMPQVPNVLSPANVP-----SMGAMRRRHTDKYSMALS---------------SEIAPN 460

  Fly   319 REFYKNADVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRTNLSLH 383
            .|||||||||||||||:||||||::|.|.||||||||:||..||.||||||||||||:|.|||||
Zfish   461 YEFYKNADVRPPFTYATLIRQAIMESSDMQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLH 525

  Fly   384 KCFVRYEDDFGSFWMVDDNEFVKRRHLSRGRPRKYEPSSSPNSCQSGNGVPTDKNPCDNCTQHCT 448
            |||||.|:..|:.|.||:.|:.|||                  .|...|.||             
Zfish   526 KCFVRVENVKGAVWTVDEMEYQKRR------------------SQKITGSPT------------- 559

  Fly   449 SLPPGADNPLDSNNPNDLGRIGC--------------LPYCGSDGLSKASKD---------YSNM 490
                     |..|.|:.|| .|.              ||..|:.||..::..         .|..
Zfish   560 ---------LVKNLPSSLG-YGAALNASLQAALAETTLPLLGNPGLMNSASAMMGASPPVMMSGS 614

  Fly   491 DSGMIESNSHL----TIDEYSTNMYES 513
            .:|:::..:|.    |:|...||.:.|
Zfish   615 PTGLLQGTTHEELNGTLDHLDTNGHSS 641

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777 46/67 (69%)
FH 328..400 CDD:238016 54/72 (75%)
foxp2NP_001025253.1 FOXP-CC 305..372 CDD:292777 46/67 (69%)
FH 470..542 CDD:238016 54/72 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4385
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001061
OrthoInspector 1 1.000 T595786
orthoMCL 1 0.900 OOG5_129522
Panther 1 1.100 O PTHR45796
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.