DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: FoxP and FOXP3

Sequence 1:NP_001247011.1 Gene:FoxP FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_016885056.1 Gene:FOXP3 HGNCID:6106 Length:473 Species:Homo sapiens

Alignment Length:476 Identity:122/477 (26%)
Similarity:186/477 (39%) Gaps:153/477 (32%)


  Fly    50 PPTGFLNNSITFASHVVKCS---SPASSIDESSTAAQQHESNPHMHIQGQHMMA------PVPDL 105
            |...|....:...:|....|   .|.|.:..|:..|  |...|.:.:......|      |....
Human    58 PGGTFQGRDLRGGAHASSSSLNPMPPSQLQLSTVDA--HARTPVLQVHPLESPAMISLTPPTTAT 120

  Fly   106 GFYNVP--------------EFISEQEKLMFSDAERFLRSKDNEVCNNDFSYMHDEFAMRKYYHP 156
            |.:::.              |::|.:..|:.:........||:.:.           |:.:..:|
Human   121 GVFSLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKDSTLS-----------AVPQSSYP 174

  Fly   157 LFAHGICRWPGCEMDLEDITSFVKHLNTEHGLDDRSTAQARVQMQVVSQLESHLQKERDRLQAMM 221
            |.|:|:|:|||||...|:...|:||...:|.||::..||..:|.::|..||..|..|:::|.||.
Human   175 LLANGVCKWPGCEKVFEEPEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQ 239

  Fly   222 HHLYLSKQLLSPTKIDRKDVPGREGKFCRSPLTVNSIGRPIRQTNSPSPL----NLPMVNSTNLC 282
            .||.....|...:.:...|    :|..|            |....|..|:    :.|.....:|.
Human   240 AHLAGKMALTKASSVASSD----KGSCC------------IVAAGSQGPVVPAWSGPREAPDSLF 288

  Fly   283 SIKKR---NHDKNTFSINGGLPYMLERAGLDVQQEIHRNREFYKNADVRPPFTYASLIRQAIIDS 344
            ::::.   :|..:||                  .|...|.:::|..::|||||||:|||.||:::
Human   289 AVRRHLWGSHGNSTF------------------PEFLHNMDYFKFHNMRPPFTYATLIRWAILEA 335

  Fly   345 PDKQLTLNEIYNWFQNTFCYFRRNAATWK------------------------------------ 373
            |:||.||||||:||...|.:||.:.||||                                    
Human   336 PEKQRTLNEIYHWFTRMFAFFRNHPATWKVSSSEVAVTGMASSAIAAQSGQAWVWAHRHIGEERD 400

  Fly   374 ------------------------NAIRTNLSLHKCFVRYEDDFGSFWMVDDNEFVKRRHLSRGR 414
                                    ||||.||||||||||.|.:.|:.|.||:.||.|:|      
Human   401 VGCWWWLLASEVDAHLLPVPGLPQNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKR------ 459

  Fly   415 PRKYEPSSSPNSCQSGNGVPT 435
                  |..|:.|.:    ||
Human   460 ------SQRPSRCSN----PT 470

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777 28/67 (42%)
FH 328..400 CDD:238016 48/132 (36%)
FOXP3XP_016885056.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4385
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 196 1.000 Inparanoid score I3755
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45796
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.