| Sequence 1: | NP_001247011.1 | Gene: | FoxP / 41182 | FlyBaseID: | FBgn0262477 | Length: | 520 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_016885056.1 | Gene: | FOXP3 / 50943 | HGNCID: | 6106 | Length: | 473 | Species: | Homo sapiens | 
| Alignment Length: | 476 | Identity: | 122/476 - (25%) | 
|---|---|---|---|
| Similarity: | 186/476 - (39%) | Gaps: | 153/476 - (32%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    50 PPTGFLNNSITFASHVVKCS---SPASSIDESSTAAQQHESNPHMHIQGQHMMA------PVPDL 105 
  Fly   106 GFYNVP--------------EFISEQEKLMFSDAERFLRSKDNEVCNNDFSYMHDEFAMRKYYHP 156 
  Fly   157 LFAHGICRWPGCEMDLEDITSFVKHLNTEHGLDDRSTAQARVQMQVVSQLESHLQKERDRLQAMM 221 
  Fly   222 HHLYLSKQLLSPTKIDRKDVPGREGKFCRSPLTVNSIGRPIRQTNSPSPL----NLPMVNSTNLC 282 
  Fly   283 SIKKR---NHDKNTFSINGGLPYMLERAGLDVQQEIHRNREFYKNADVRPPFTYASLIRQAIIDS 344 
  Fly   345 PDKQLTLNEIYNWFQNTFCYFRRNAATWK------------------------------------ 373 
  Fly   374 ------------------------NAIRTNLSLHKCFVRYEDDFGSFWMVDDNEFVKRRHLSRGR 414 
  Fly   415 PRKYEPSSSPNSCQSGNGVPT 435 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| FoxP | NP_001247011.1 | FOXP-CC | 157..224 | CDD:292777 | 27/66 (41%) | 
| FH | 328..400 | CDD:238016 | 47/131 (36%) | ||
| FOXP3 | XP_016885056.1 | None | |||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 126 | 1.000 | Domainoid score | I5407 | 
| eggNOG | 1 | 0.900 | - | - | E2759_KOG4385 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 177 | 1.000 | Inparanoid score | I4046 | 
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR45796 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.960 | |||||