DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxP and fd102C

DIOPT Version :9

Sequence 1:NP_001247011.1 Gene:FoxP / 41182 FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster


Alignment Length:187 Identity:52/187 - (27%)
Similarity:85/187 - (45%) Gaps:24/187 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 NGGLPYMLERAGLDVQQEIHRNREFYKNADVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNT 361
            :|.||.:...|.|.......:.:..::..:.:|..:|..||..||:.|.|.:|.|::||.:..:.
  Fly    98 SGSLPSVNRMAALSTISLFPQTQRIFQPEEPKPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDN 162

  Fly   362 FCYFRRNAATWKNAIRTNLSLHKCFV---RYEDDFGSFWMV---DDNEFVK---RRHLSRGRPRK 417
            :.|||.....|:|:||.||||:.||:   |..:..|.:|.:   :..:|.|   ||..::.:.||
  Fly   163 YPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSANGKGHYWAIHPANMEDFRKGDFRRRKAQRKVRK 227

  Fly   418 YEPSSSPNSCQSGNGVPTDKNPCDNCTQHCTSLPPGADNPLDSNNPNDLGRIGCLPY 474
            :...|..::.......|    |.|..|      ||    |..|.:...|..:| .||
  Fly   228 HMGLSVDDASTDSPSPP----PLDLTT------PP----PPSSQSALQLSALG-YPY 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777
FH 328..400 CDD:238016 28/77 (36%)
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 29/83 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445494
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.