DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: FoxP and foxo

Sequence 1:NP_001247011.1 Gene:FoxP FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001262557.1 Gene:foxo FlyBaseID:FBgn0038197 Length:622 Species:Drosophila melanogaster

Alignment Length:196 Identity:60/197 (30%)
Similarity:83/197 (42%) Gaps:53/197 (27%)


  Fly   310 DVQQEIHRNREFYKNADVRPPF---TYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFR----- 366
            |.||.|.......||:..|..:   :||.||..||..:.||:|||::||.|......||:     
  Fly    74 DSQQAIQNANAAKKNSSRRNAWGNLSYADLITHAIGSATDKRLTLSQIYEWMVQNVPYFKDKGDS 138

  Fly   367 RNAATWKNAIRTNLSLHKCFVRYEDD---FGSFWMVD----DNEFVKRRHLS---------RGRP 415
            .::|.|||:||.|||||..|:|.:::   ..|:||::    ..:.|:||..|         |||.
  Fly   139 NSSAGWKNSIRHNLSLHNRFMRVQNEGTGKSSWWMLNPEAKPGKSVRRRAASMETSRYEKRRGRA 203

  Fly   416 RKY-----------------EPSSS--------PNS-CQSGNGV---PTDKNPCDNCTQHCTSLP 451
            :|.                 .||||        |.| ..||.|.   |..:....:....|..|.
  Fly   204 KKRVEALRQAGVVGLNDATPSPSSSVSEGLDHFPESPLHSGGGFQLSPDFRQRASSNASSCGRLS 268

  Fly   452 P 452
            |
  Fly   269 P 269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777
FH 328..400 CDD:238016 33/83 (40%)
foxoNP_001262557.1 FH 95..175 CDD:238016 32/80 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114235147
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.