DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: FoxP and FoxK

Sequence 1:NP_001247011.1 Gene:FoxP FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001261701.1 Gene:FoxK FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster

Alignment Length:594 Identity:133/595 (22%)
Similarity:211/595 (35%) Gaps:187/595 (31%)


  Fly    52 TGFLNNSITFASHVVKCSSPASSIDESSTAAQQH------------ESNPHMHIQGQHMMAPVPD 104
            ||..|||   |:|....||..:|...|:|:|..:            .|.|:..::....:.|:.|
  Fly   107 TGNSNNS---ANHPPATSSTTNSSSSSTTSANTNNPSANAASTLTSSSPPYGELRFNQEVLPITD 168

  Fly   105 ------------LGFYNVPE--FISEQEKLMFSDAERFLRSKDNEVCNNDFSYMHDEFAMRKYYH 155
                        |..:||.|  .:|.:...:..|.|  ||:...: |.:......|:|..|:...
  Fly   169 AVTVIGRNSSTSLVHFNVAENNLVSRKHFQVLYDVE--LRAFFVQ-CLSKNGIFVDDFLQRRNVD 230

  Fly   156 PLFAHGIC--RWPGCEMDLEDITSFVKHLNTEHGLDDRSTA------------------------ 194
            ||.....|  |:|..|:.:| ..|:|...::: .:|..|.:                        
  Fly   231 PLRLPQRCYFRFPSTEIRIE-FESYVPATSSD-AIDGHSPSLVVGGGGGVAGGGAHVIITPLPRD 293

  Fly   195 QARVQMQVVSQLESHLQKERDRLQAMMHHLYLSKQ------------------------------ 229
            :...|.....|.:.|||:::.......|||.|.:|                              
  Fly   294 ELHQQQLHHHQQQPHLQQQQHPHHPPAHHLPLQQQQQQQQPAHHPLPHTPHHPLHHTALHQQQQR 358

  Fly   230 ----LLSPTKIDRKDVPGREGKFCRSPLTVNSIGRPIRQTNSP--SPLNLPMVNSTNLCSIKKR- 287
                :::|.......:...:|....|||   .|..|.::..||  ||..  .:::.|.|....| 
  Fly   359 SGSIVVAPPAGAAAHLIAGDGPGIYSPL---KISIPKKEQKSPYLSPTG--TISAANSCPASPRQ 418

  Fly   288 ---NHDKNTFSINGGLPYMLERAGLDVQQEIHRNREFYK-------NADVRPPFTYASLIRQAII 342
               .:..|.::..|.                :..::.::       |.:.:||::||.||.|||.
  Fly   419 GFIQNQPNNYNNYGN----------------NNTQDLFQTPSTASYNHNEKPPYSYAQLIVQAIS 467

  Fly   343 DSPDKQLTLNEIYNWFQNTFCYFRRNA-ATWKNAIRTNLSLHKCFVRY-----EDDFGSFWMVD- 400
            .:|||||||:.||::....:.|:|:.. ..|:|:||.||||::.|::.     |...||||.:| 
  Fly   468 AAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDP 532

  Fly   401 -------DNEFVKRRHLSR-------GRPRK--YEPSSSPNS----------CQSGNGVP---TD 436
                   |:.:.|||..|.       |.||.  ..||...||          .||..|.|   .:
  Fly   533 DSGAKLIDHSYKKRRQRSSQGFRPPYGMPRSAPVSPSHMDNSRESSPLQDIVLQSAPGSPGMSLE 597

  Fly   437 KNPCD--------NCTQHCTSLPPGADNPLDSNNPNDLGRIGCLPYCGSDGLSKASKDY-SNMDS 492
            :...|        |..|..............|||.|.              .|..|..| :|..|
  Fly   598 QRAADPEIIYNSQNAHQQQQQQQQQQQQQTLSNNSNQ--------------YSSGSPYYVTNQSS 648

  Fly   493 GMIESNSHL 501
            |:....:|:
  Fly   649 GVATPQTHV 657

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777 17/93 (18%)
FH 328..400 CDD:238016 34/78 (44%)
FoxKNP_001261701.1 FHA <170..253 CDD:238017 20/87 (23%)
Forkhead 453..540 CDD:278670 35/87 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114235566
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.