DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: FoxP and Foxp4

Sequence 1:NP_001247011.1 Gene:FoxP FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_008765090.1 Gene:Foxp4 RGDID:1311386 Length:684 Species:Rattus norvegicus

Alignment Length:364 Identity:158/365 (43%)
Similarity:200/365 (55%) Gaps:61/365 (17%)


  Fly   155 HPLFAHGICRWPGCEMDLEDITSFVKHLNTEHGLDDRSTAQARVQMQVVSQLESHLQKERDRLQA 219
            |||:.||.|:|||||...||:..|:|||||||.||||||||.|||||||.|||..|.||.:||||
  Rat   306 HPLYGHGECKWPGCETLCEDLGQFIKHLNTEHALDDRSTAQCRVQMQVVQQLEIQLAKESERLQA 370

  Fly   220 MMHHLYLSKQLLSPTKIDRKDVPGREGKFCRSPLTVNSIGRPIRQTNSP-------SPLNLPMVN 277
            ||.||::......|.......||| ...|  |.:||::...|....:.|       :||..|.:.
  Rat   371 MMAHLHMRPSEPKPFSQPLNPVPG-SSSF--SKVTVSADPFPDGLVHPPTSAAAPVTPLRPPGLG 432

  Fly   278 STNLCS---IKKRNHDKNTFSINGGLPYMLERAGLDVQQEIHRNREFYKNADVRPPFTYASLIRQ 339
            |.:|..   .::|::||....|:               .|:.:|.||||||||||||||||||||
  Rat   433 SASLHGGGPARRRSNDKFCSPIS---------------SELAQNHEFYKNADVRPPFTYASLIRQ 482

  Fly   340 AIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRTNLSLHKCFVRYEDDFGSFWMVDDNEF 404
            ||:::||:|||||||||||...|.|||||.||||||:|.||||||||||.|:..|:.|.||:.|:
  Rat   483 AILETPDRQLTLNEIYNWFTRMFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEREY 547

  Fly   405 VKRRHLSRGRPRKYEPS-----------------SSPNSCQSGNGVPTDKNPCDNCTQHCTSLPP 452
            .||      ||.|...|                 :|..:..:.:..|...:|        ..|.|
  Rat   548 QKR------RPPKMTGSPTLVKNMISGLSYGALNASYQAALAESSFPLLSSP--------GMLNP 598

  Fly   453 GADNPLDSNNPNDLGRIG-CLPYCGSDGLSKAS-KDYSN 489
            |:.:.|...:.:|:|..| .||..||....:.| ..||:
  Rat   599 GSASSLLPLSQDDMGAPGEPLPSNGSSSPPRLSPPQYSH 637

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777 47/67 (70%)
FH 328..400 CDD:238016 54/72 (75%)
Foxp4XP_008765090.1 FOXP-CC 308..375 CDD:292777 47/67 (70%)
Forkhead 471..550 CDD:278670 57/79 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4385
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001061
OrthoInspector 1 1.000 T617237
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45796
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.