DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: FoxP and slp2

Sequence 1:NP_001247011.1 Gene:FoxP FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_476834.1 Gene:slp2 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster

Alignment Length:323 Identity:75/324 (23%)
Similarity:111/324 (34%) Gaps:153/324 (47%)


  Fly   267 SPSPLNLPMVNSTNLCSIKKRNHDKNTFSINGGLPYMLERAGLDVQQEI-----------HRN-- 318
            ||.|:.|   |.|||..:.:..|.|::||||..||..:|....|.::::           |.|  
  Fly    38 SPHPVGL---NLTNLMKMARTPHLKSSFSINSILPETVEHHDEDEEEDVEKKSPAKFPPNHNNNN 99

  Fly   319 --------------------------------------------REFY----------------- 322
                                                        .||.                 
  Fly   100 LNTTNWGSPEDHEAESDPESDLDVTSMSPAPVANPNESDPDEVDEEFVEEDIECDGETTDGDAEN 164

  Fly   323 ----------KNADVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIR 377
                      |..:.:||::|.:||..||..|.:|:||||.||.:......|:|.|...|:|:||
  Fly   165 KSNDGKPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIR 229

  Fly   378 TNLSLHKCFV---RYEDD--FGSFWMVD---DNEFV-------KRRHLSRGRPR----------- 416
            .||||:||||   |:.||  .|::||:|   ::.|:       :||..:..|.|           
  Fly   230 HNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIGP 294

  Fly   417 ---------------KYEPSS-----------SPNSCQSGNGVPTDKNPCDNCTQHCTSLPPG 453
                           .|.|::           :|.:.:.|.|.|              .||||
  Fly   295 MFPGLAAYPQFGQFLTYPPTAPSLLASMYQRYNPFAPKGGPGHP--------------GLPPG 343

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777
FH 328..400 CDD:238016 36/77 (47%)
slp2NP_476834.1 Forkhead 180..265 CDD:306709 38/85 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114235323
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.