DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: FoxP and Foxp3

Sequence 1:NP_001247011.1 Gene:FoxP FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_006256793.1 Gene:Foxp3 RGDID:1562112 Length:488 Species:Rattus norvegicus

Alignment Length:336 Identity:113/337 (34%)
Similarity:168/337 (50%) Gaps:73/337 (22%)


  Fly   112 EFISEQEKLMFSDAERFLRS----KDNEVCNNDFSYMHDEFAMRKYYHPLFAHGICRWPGCEMDL 172
            |::|.:..|:.:    |.||    ||:.:           .|..:..:||.|:|:|:|||||...
  Rat   218 EWVSREPALLCT----FPRSGTPRKDSNL-----------LAAPQGSYPLLANGVCKWPGCEKAF 267

  Fly   173 EDITSFVKHLNTEHGLDDRSTAQARVQMQVVSQLESHLQKERDRLQAMMHHLYLSKQLLSPTKID 237
            |:...|:||...:|.||::..||..:|.:||..||..|:.|:::|.||..||.....|.....:.
  Rat   268 EEPGEFLKHCQADHLLDEKGKAQCLLQREVVQSLEQQLELEKEKLGAMQAHLAGKMALTKAPPVA 332

  Fly   238 RKDVPGREGKFCRSPLTVNSIGRPIRQTNSPSPLNLPMVNSTNLCSIKKR---NHDKNTFSINGG 299
            ..|    :...|.  :..::.|..:...:||...      |.:|.::::.   :|..:||     
  Rat   333 SVD----KSSCCL--VATSTQGSVLPAWSSPREA------SDSLFAVRRHLWGSHGNSTF----- 380

  Fly   300 LPYMLERAGLDVQQEIHRNREFYKNADVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCY 364
                         .|...|.:::|..::|||||||:|||.||:::|::|.||||||:||...|.|
  Rat   381 -------------PEFFHNMDYFKYHNMRPPFTYATLIRWAILEAPERQRTLNEIYHWFTRMFAY 432

  Fly   365 FRRNAATWKNAIRTNLSLHKCFVRYEDDFGSFWMVDDNEFVKRRHLSRGRPRKYEPSSSPNSCQS 429
            ||.:.||||||||.||||||||||.|.:.|:.|.||:.||.|:|            |..|:.|  
  Rat   433 FRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDEFEFRKKR------------SQRPSKC-- 483

  Fly   430 GNGVPTDKNPC 440
                   .|||
  Rat   484 -------SNPC 487

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777 29/67 (43%)
FH 328..400 CDD:238016 48/72 (67%)
Foxp3XP_006256793.1 FOXP-CC 252..319 CDD:292777 29/67 (43%)
Forkhead 396..469 CDD:278670 49/73 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4385
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 198 1.000 Inparanoid score I3670
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45796
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.