DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxP and Foxp3

DIOPT Version :9

Sequence 1:NP_001247011.1 Gene:FoxP / 41182 FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_038955722.1 Gene:Foxp3 / 317382 RGDID:1562112 Length:457 Species:Rattus norvegicus


Alignment Length:336 Identity:113/336 - (33%)
Similarity:168/336 - (50%) Gaps:73/336 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 EFISEQEKLMFSDAERFLRS----KDNEVCNNDFSYMHDEFAMRKYYHPLFAHGICRWPGCEMDL 172
            |::|.:..|:.:    |.||    ||:.:           .|..:..:||.|:|:|:|||||...
  Rat   187 EWVSREPALLCT----FPRSGTPRKDSNL-----------LAAPQGSYPLLANGVCKWPGCEKAF 236

  Fly   173 EDITSFVKHLNTEHGLDDRSTAQARVQMQVVSQLESHLQKERDRLQAMMHHLYLSKQLLSPTKID 237
            |:...|:||...:|.||::..||..:|.:||..||..|:.|:::|.||..||.....|.....:.
  Rat   237 EEPGEFLKHCQADHLLDEKGKAQCLLQREVVQSLEQQLELEKEKLGAMQAHLAGKMALTKAPPVA 301

  Fly   238 RKDVPGREGKFCRSPLTVNSIGRPIRQTNSPSPLNLPMVNSTNLCSIKKR---NHDKNTFSINGG 299
            ..|    :...|.  :..::.|..:...:||...      |.:|.::::.   :|..:||     
  Rat   302 SVD----KSSCCL--VATSTQGSVLPAWSSPREA------SDSLFAVRRHLWGSHGNSTF----- 349

  Fly   300 LPYMLERAGLDVQQEIHRNREFYKNADVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCY 364
                         .|...|.:::|..::|||||||:|||.||:::|::|.||||||:||...|.|
  Rat   350 -------------PEFFHNMDYFKYHNMRPPFTYATLIRWAILEAPERQRTLNEIYHWFTRMFAY 401

  Fly   365 FRRNAATWKNAIRTNLSLHKCFVRYEDDFGSFWMVDDNEFVKRRHLSRGRPRKYEPSSSPNSCQS 429
            ||.:.||||||||.||||||||||.|.:.|:.|.||:.||.|:|            |..|:.|  
  Rat   402 FRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDEFEFRKKR------------SQRPSKC-- 452

  Fly   430 GNGVPTDKNPC 440
                   .|||
  Rat   453 -------SNPC 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777 28/66 (42%)
FH 328..400 CDD:238016 47/71 (66%)
Foxp3XP_038955722.1 FOXP-CC 221..288 CDD:406546 28/66 (42%)
FH_FOXP3 365..445 CDD:410840 52/79 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5287
eggNOG 1 0.900 - - E2759_KOG4385
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45796
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.