DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: FoxP and fkh-7

Sequence 1:NP_001247011.1 Gene:FoxP FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001023147.1 Gene:fkh-7 WormBaseID:WBGene00001439 Length:778 Species:Caenorhabditis elegans

Alignment Length:358 Identity:122/359 (34%)
Similarity:162/359 (45%) Gaps:90/359 (25%)


  Fly   155 HPLFAHGICRWPGCEMDLEDITSFVKHLNTEHGLDDRSTAQARVQMQVVSQLESHLQKERDRLQA 219
            |.|:.||:|.||.|:...:.:.:.:.||..||...|:|..:.|.|::.|..:|..|..||.|||.
 Worm   324 HALWQHGMCAWPSCDQPCDSVMALITHLQHEHPPSDKSNEEMRNQIEKVESIEHKLSVERSRLQG 388

  Fly   220 MMHHLYL--SKQLLSPTKIDRK-DVPGREGKFCRSPLTVNSIGRPIRQTNS-------------- 267
            ||.||.:  |....:|..:..: ..|.|..|...:..::....:..:||.|              
 Worm   389 MMQHLRMKPSPDTTTPNLVKMEAQSPLRSPKIEGAAFSIQPAQQFQQQTTSQPQVSPTSEAASSL 453

  Fly   268 ---------------PSPLN----LPMVNSTNLCSIKKRNHDKNTFS------INGGLPYMLERA 307
                           .||:|    :|.|:|..    ...||..:|.|      .:|....:|:||
 Worm   454 LSIAATVAASTAAAVTSPINQISTVPSVSSMP----SFLNHQLSTSSQPSSQQASGSSGPLLQRA 514

  Fly   308 GLDVQQE----------------------------IHRNREFYKNADVRPPFTYASLIRQAIIDS 344
            ......|                            |.:||:||:..|||||:||||||||||::|
 Worm   515 ASSASTETSPNPDSKSFVPRRSRISDKTVQPIATDIAKNRDFYRTNDVRPPYTYASLIRQAIMES 579

  Fly   345 PDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRTNLSLHKCFVRYEDDF-GSFWMVDDNEFVKRR 408
            .|.||||||||.||..||.||||||||||||:|.||||||||.|.|.:. |:.|.|||:||.:||
 Worm   580 SDCQLTLNEIYTWFTETFAYFRRNAATWKNAVRHNLSLHKCFQRVEQNVKGAVWTVDDSEFYRRR 644

  Fly   409 HLSRGRPRKYEPSSSPNSCQSGNGVPTDKNPCD 441
                           ||...:....|....|.|
 Worm   645 ---------------PNRASATRSQPQTPLPDD 662

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777 26/67 (39%)
FH 328..400 CDD:238016 53/73 (73%)
fkh-7NP_001023147.1 FOXP-CC 326..393 CDD:292777 26/67 (39%)
Forkhead 563..638 CDD:278670 55/75 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4385
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4184
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001061
OrthoInspector 1 1.000 T477490
orthoMCL 1 0.900 OOG5_129522
Panther 1 1.100 LDO PTHR45796
Phylome 1 0.910 0.938 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4064
TreeFam 1 0.960
98.750

Return to query results.
Submit another query.