DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: FoxP and FOXP4

Sequence 1:NP_001247011.1 Gene:FoxP FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_011512591.1 Gene:FOXP4 HGNCID:20842 Length:687 Species:Homo sapiens

Alignment Length:387 Identity:158/388 (41%)
Similarity:193/388 (50%) Gaps:96/388 (25%)


  Fly   155 HPLFAHGICRWPGCEMDLEDITSFVKHLNTEHGLDDRSTAQARVQMQVVSQLESHLQKERDRLQA 219
            |||:.||.|:|||||...||:..|:|||||||.||||||||.|||||||.|||..|.||.:||||
Human   308 HPLYGHGECKWPGCETLCEDLGQFIKHLNTEHALDDRSTAQCRVQMQVVQQLEIQLAKESERLQA 372

  Fly   220 MMHHLYLSKQLLSPTKIDRKDVPGREGKFCRSPLTVNS-------IGRPIRQTNSP-SPLNLPMV 276
            ||.||::......|.......||| ...|  |.:||::       :..|.....:| :||..|.:
Human   373 MMAHLHMRPSEPKPFSQPLNPVPG-SSSF--SKVTVSAADSFPDGLVHPPTSAAAPVTPLRPPGL 434

  Fly   277 NSTNLCSIKKRNHDKNTFSINGGLPYMLERAGLD-----VQQEIHRNREFYKNADVRPPFTYASL 336
            .|.               |::||.|  ..|...|     :..|:.:|.|||||||||||||||||
Human   435 GSA---------------SLHGGGP--ARRRSSDKFCSPISSELAQNHEFYKNADVRPPFTYASL 482

  Fly   337 IRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRTNLSLHKCFVRYEDDFGSFWMVDD 401
            |||||:::||:|||||||||||...|.|||||.||||||:|.||||||||||.|:..|:.|.||:
Human   483 IRQAILETPDRQLTLNEIYNWFTRMFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDE 547

  Fly   402 NEFVKRR----------------HLSRGR-PRKYEPS---------SSPNSCQSGN--------- 431
            .|:.|||                .||.|. ...|:.:         :||.....|:         
Human   548 REYQKRRPPKMTGSPTLVKNMISGLSYGALNASYQAALAESSFPLLNSPGMLNPGSASSLLPLSH 612

  Fly   432 ---GVPTDKNPCDNCTQHCTSLPP-------------------------GADNPLDSNNPND 465
               |.|.:..|.:..:......||                         ||.||..|..|.|
Human   613 DDVGAPVEPLPSNGSSSPPRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPED 674

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777 47/67 (70%)
FH 328..400 CDD:238016 54/72 (75%)
FOXP4XP_011512591.1 FOXP-CC 310..377 CDD:292777 47/67 (70%)
Forkhead 474..553 CDD:278670 57/79 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4385
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001061
OrthoInspector 1 1.000 T608287
orthoMCL 1 0.900 OOG5_129522
Panther 1 1.100 O PTHR45796
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4064
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.