| Sequence 1: | NP_001247011.1 | Gene: | FoxP / 41182 | FlyBaseID: | FBgn0262477 | Length: | 520 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_036021645.1 | Gene: | Foxp2 / 114142 | MGIID: | 2148705 | Length: | 740 | Species: | Mus musculus | 
| Alignment Length: | 371 | Identity: | 159/371 - (42%) | 
|---|---|---|---|
| Similarity: | 202/371 - (54%) | Gaps: | 75/371 - (20%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly   142 SYMHDEFAMRKYYHPLFAHGICRWPGCEMDLEDITSFVKHLNTEHGLDDRSTAQARVQMQVVSQL 206 
  Fly   207 ESHLQKERDRLQAMMHHLYLSK----------QLLSPTKIDRKDVPGREGKFCRSPLTVNSIGRP 261 
  Fly   262 IRQTNSPS---PLNLPMVNSTNLCSIKKRNHDKNTFSINGGLPYMLERAGLDVQQEIHRNREFYK 323 
  Fly   324 NADVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRTNLSLHKCFVR 388 
  Fly   389 YEDDFGSFWMVDDNEFVKRRHLSRGRPRKYEPSSSPNSCQSGNGVPT-DKN-PCDNCTQHCTSLP 451 
  Fly   452 PGADNPLDSNNPNDLGRIGCLPYCGSDGLSKASKDYSNMDSGMIES 497 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| FoxP | NP_001247011.1 | FOXP-CC | 157..224 | CDD:292777 | 46/66 (70%) | 
| FH | 328..400 | CDD:238016 | 53/71 (75%) | ||
| Foxp2 | XP_036021645.1 | FOXP-CC | 367..434 | CDD:406546 | 46/66 (70%) | 
| COG5025 | 502..>733 | CDD:227358 | 94/214 (44%) | ||
| FH_FOXP2 | 528..609 | CDD:410839 | 58/80 (73%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 126 | 1.000 | Domainoid score | I5382 | 
| eggNOG | 1 | 0.900 | - | - | E2759_KOG4385 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S4184 | 
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0001519 | |
| OrthoInspector | 1 | 1.000 | - | - | otm43440 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_103982 | |
| Panther | 1 | 1.100 | - | - | O | PTHR45796 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X957 | |
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 1 | 0.960 | - | - | ||
| 11 | 10.720 | |||||