DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: FoxP and Foxp1

Sequence 1:NP_001247011.1 Gene:FoxP FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_006505387.1 Gene:Foxp1 MGIID:1914004 Length:723 Species:Mus musculus

Alignment Length:465 Identity:183/466 (39%)
Similarity:241/466 (52%) Gaps:111/466 (24%)


  Fly    69 SSPASSIDESST----AAQQHES---NPHMHIQGQHMMAPVPDLGFYNVPEFISEQEKLMFSDAE 126
            ||..||:|.:||    :|....|   |||....|| :....|            ::|.|      
Mouse   276 SSNHSSLDLTSTCVSSSAPSKSSLIMNPHASTNGQ-LSVHTP------------KRESL------ 321

  Fly   127 RFLRSKDNEVCNNDFSYMHDEFAMRKYYHPLFAHGICRWPGCEMDLEDITSFVKHLNTEHGLDDR 191
                             .|:|   ..:.|||:.||:|:|||||...:|..:|:||||:||.||||
Mouse   322 -----------------SHEE---HPHSHPLYGHGVCKWPGCEAVCDDFPAFLKHLNSEHALDDR 366

  Fly   192 STAQARVQMQVVSQLESHLQKERDRLQAMMHHLYLSKQLLSPTKIDRKDVPGREGKFCRSPLTVN 256
            ||||.|||||||.|||..|.|:::||||||.||:               |...|.|....||.:.
Mouse   367 STAQCRVQMQVVQQLELQLAKDKERLQAMMTHLH---------------VKSTEPKAAPQPLNLV 416

  Fly   257 SIGRPIRQTNSPSPLNLP------------------MVNSTNLCS---IKKRNHDKNTFSINGGL 300
            |.....:..:..||.:||                  ::.:|::.:   |::|..||....|:.. 
Mouse   417 SSVTLSKSASEASPQSLPHTPTTPTAPLTPVTQGPSVITTTSMHTVGPIRRRYSDKYNVPISSA- 480

  Fly   301 PYMLERAGLDVQQEIHRNREFYKNADVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYF 365
                         :|.:|:||||||:|||||||||||||||::||:||||||||||||...|.||
Mouse   481 -------------DIAQNQEFYKNAEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYF 532

  Fly   366 RRNAATWKNAIRTNLSLHKCFVRYEDDFGSFWMVDDNEFVKRRHLSRGRPRKYEPSSSPNSCQSG 430
            ||||||||.||||||||||||:|.||:|||||.|||.||::.||:.|||||||.|..  ||.:.|
Mouse   533 RRNAATWKGAIRTNLSLHKCFIRVEDEFGSFWTVDDEEFIRGRHIQRGRPRKYCPGE--NSDELG 595

  Fly   431 NGVPTDKNPCDNCTQHCTSLPPG-----ADNPLDSNNPNDLGRIGCLPYCGSDGLSKASKDYSNM 490
            ...|:......:...:||.|...     |:|.:.......:|.    |..||  |:.|.::  .:
Mouse   596 AHNPSLIKNMQSSHAYCTPLNAALQASMAENSIPLYTTASMGN----PTLGS--LASAIRE--EL 652

  Fly   491 DSGMIESNSH 500
            :..|..:||:
Mouse   653 NGAMEHTNSN 662

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777 44/67 (66%)
FH 328..400 CDD:238016 60/72 (83%)
Foxp1XP_006505387.1 FOXP-CC 332..399 CDD:292777 44/67 (66%)
FH 495..567 CDD:238016 60/72 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4385
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001061
OrthoInspector 1 1.000 T615126
orthoMCL 1 0.900 OOG5_129522
Panther 1 1.100 LDO PTHR45796
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4064
TreeFam 1 0.960
87.800

Return to query results.
Submit another query.