DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: FoxP and foxp2

Sequence 1:NP_001247011.1 Gene:FoxP FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_012813833.1 Gene:foxp2 XenbaseID:XB-GENE-482683 Length:745 Species:Xenopus tropicalis

Alignment Length:365 Identity:155/366 (42%)
Similarity:197/366 (54%) Gaps:63/366 (17%)


  Fly   142 SYMHDEFAMRKYYHPLFAHGICRWPGCEMDLEDITSFVKHLNTEHGLDDRSTAQARVQMQVVSQL 206
            |..|:|....   |.|:.||:|:|||||...||...|:||||.||.||||||||.|||||||.||
 Frog   330 SSSHEETGAS---HTLYGHGVCKWPGCENICEDFGQFLKHLNNEHALDDRSTAQCRVQMQVVQQL 391

  Fly   207 ESHLQKERDRLQAMMHHLYLSK----------QLLSPTKIDRKDVPGREGKFCRSPLTVNSIGRP 261
            |..|.|||:||||||.||::..          .|:|...:.:..:........::|.|..:...|
 Frog   392 EIQLSKERERLQAMMTHLHMRPSEPKPSPKPLNLVSTVTMSKNMLETSPQSLPQTPTTPTAPVTP 456

  Fly   262 IRQTNSPS---PLNLPMVNSTNLCSIKKRNHDKNTFSINGGLPYMLERAGLDVQQEIHRNREFYK 323
            |.|  .||   |.::|     |:.:|::|:.||               ..:.:..||..|.||||
 Frog   457 IAQ--GPSVITPASVP-----NVGAIRRRHSDK---------------YNIPMSTEIAPNYEFYK 499

  Fly   324 NADVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRTNLSLHKCFVR 388
            |||||||||||:||||||::|.|:||||||||:||..||.||||||||||||:|.||||||||||
 Frog   500 NADVRPPFTYATLIRQAIMESGDRQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHKCFVR 564

  Fly   389 YEDDFGSFWMVDDNEFVKRRHLS-RGRPR--KYEPSS---------SPNSCQSGNGVPTDKNPCD 441
            .|:..|:.|.||:.|:.|||... .|.|.  |..|:|         |..:..:.:.:|...|   
 Frog   565 VENVKGAVWTVDEAEYQKRRSQKITGSPTLVKNIPTSLGYGAALNASLQAALAESSLPLLSN--- 626

  Fly   442 NCTQHCTSLPPG--------ADNPLDSNNPNDLGRIGCLP 473
              |....:..||        .:..||..:.|.....||.|
 Frog   627 --TGLLNNASPGLLQAVHEDLNGSLDHIDSNGNSSPGCSP 664

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777 47/67 (70%)
FH 328..400 CDD:238016 54/72 (75%)
foxp2XP_012813833.1 FOXP-CC 342..409 CDD:292777 47/67 (70%)
Forkhead 504..582 CDD:278670 56/78 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4385
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001061
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.770

Return to query results.
Submit another query.