DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9492 and DNAH11

Sequence 1:NP_001287256.1 Gene:CG9492 FlyBaseID:FBgn0037726 Length:4724 Species:Drosophila melanogaster
Sequence 2:NP_001264044.1 Gene:DNAH11 HGNCID:2942 Length:4516 Species:Homo sapiens

Alignment Length:4884 Identity:1430/4885 (29%)
Similarity:2316/4885 (47%) Gaps:580/4885 (12%)


  Fly    20 GSSDDDDEEEDQGDILQRRREECERKARRGEMDPRLEF---TFQLLIDATQLPRHQLMDYIFEGD 81
            |:.:.::|||::       .|...|:||....|.|:.|   ...:::..|:....|.::......
Human    31 GAVELEEEEENE-------EEAAARRARSFAQDARVRFLGGRLAMMLGFTEEKWSQYLESEDNRQ 88

  Fly    82 MLDEINQLFLPNMKNKLLWFYQETDDPEPTPVPDPNKPGPSRSGVASSSSKTPQGGASPSGMPPP 146
            :|.|    ||.:.....|.|                  ..:.||..::|.:.|:..         
Human    89 VLGE----FLESTSPACLVF------------------SFAASGRLAASQEIPRDA--------- 122

  Fly   147 KHKKLFLTDGWTCAFTGVCIYIFRVNTSKQLPE----EGFQKDLYCGVIDAKNIGLVTSIERIVE 207
            .||.:|:                    ||::.|    ..|.:.:..|.:.|.::|.|::      
Human   123 NHKLVFI--------------------SKKITESIGVNDFSQVVLFGELPALSLGHVSA------ 161

  Fly   208 FVFMQALAFPSL--EGDEEDVSCGLIKGQLLPGLRSFCSALRVCEQVCDHH-NVFADGCDMFE-- 267
              |:..:..|.|  :.:.:..||             |.|      |..::| .|......:|.  
Human   162 --FLDEILVPVLSNKNNHKSWSC-------------FTS------QDMEYHIEVMKKKMYIFRGK 205

  Fly   268 -------KIDAVEEVKDMSKNQEFCAQ-------------LEERVNNWTKGILKILGESEQLRKE 312
                   .|..|....|:.:|   |::             :|..|..|:..|.:|:......|..
Human   206 MSRRTLLPIPTVAGKMDLDQN---CSENKPPSNERIILHAIESVVIEWSHQIQEIIERDSVQRLL 267

  Fly   313 ND-HSGPQDELEYWKKRGAQFSQLLAHLQDKEVQFTLHCLFLAGSRIIKQWKETDRKITFCYNEA 376
            |. |..||.||::|..|....|.:...||...|...:..|....|......|:....:.....||
Human   268 NGLHLSPQAELDFWMMRRENLSCIYDQLQAPVVLKMVKILTTKQSSYFPTLKDIFLAVENALLEA 332

  Fly   377 RDNSKFIQAMETCCHSLYLDDPVSMKESILSLLQTVRLIYSVSQFYNTSERTSALMVKITNQMIE 441
            :|...:::.:......|...:....:..|..|..|:.||:|.|:||||..|...|:.:..|..|.
Human   333 QDVELYLRPLRRHIQCLQETEFPQTRILIAPLFHTICLIWSHSKFYNTPARVIVLLQEFCNLFIN 397

  Fly   442 TCKSYITCRCKETIWSQDRNVIRTKLSNCIKLNHIYHETYYTVREQ---PFLPNQ-TPFGFSENF 502
            ...:|::   .|.:...:......|:...:.:...:..:::..|::   .|:..: .|:.|..:.
Human   398 QATAYLS---PEDLLRGEIEESLEKVQVAVNILKTFKNSFFNYRKKLASYFMGRKLRPWDFQSHL 459

  Fly   503 VFGKFDTFCERLSKIISMFNLIDDYNHLFERRLE-----GLLLGEALEDASNHFEEAKKEVTSRK 562
            ||.:||.|.:||.||..:|....::..|  .|||     |.:|...:.:.|....|..|......
Human   460 VFCRFDKFLDRLIKIEDIFATTLEFEKL--ERLEFGGTKGAILNGQVHEMSEELMELCKLFKQST 522

  Fly   563 YDYLDHRNSDFNIDFERFIHKTNSLKDTIATLIEKDFDTVWETPQCIRFLVRFEKVSEK-IPLTR 626
            ||..|..|.:|..|:..|..||......:.|:|.:.|..........:.|..|....|| :.:..
Human   523 YDPSDCTNMEFESDYVAFKSKTLEFDRRLGTIICEAFFNCNGLEAAFKLLTIFGNFLEKPVVMEI 587

  Fly   627 MDEKYTRILRYVEKEVD---RILKTFRKQRD--DPPLARNFPPIAGRIHWCRALSLHITELMD-- 684
            ....|:.::.....|:|   ::.....||.:  ...|.:|.|..:|.:.|.:.:...:.....  
Human   588 FSLHYSTLVHMFNTELDVCKQLYNEHMKQIECGHVVLNKNMPFTSGNMKWAQQVLQRLQMFWSNF 652

  Fly   685 AVMEHVVLSSLPMAKDLDVRYHNVLGILQEYEDEIVSIWLDQDVSVADACLLQPLL--SLQGDKL 747
            |.:.::.|.: |....:..:|..:..:|.::|..|.:.|......:.:..|.|||:  |.....|
Human   653 ASLRYLFLGN-PDHALVYQKYVEMTTLLDQFESRIYNEWKSNVDEICEFNLNQPLVKFSAINGLL 716

  Fly   748 FVNLHPTIPLLIREAK---MLAKLDIELPIVAATLMSRQQYFITIQDSLNCLIKMFLSTVRAVKL 809
            .||..|.:..::||.|   ||.|.||  |..|..:..::...:....:|:.|::.: :.::...|
Human   717 CVNFDPKLVAVLREVKYLLMLKKQDI--PDSALAIFKKRNTILKYIGNLDLLVQGY-NKLKQTLL 778

  Fly   810 EVR-PLFLPQLVRLTAMLKPGLHTINWTNQNWTEFYERCKQAIESFDVLVARVHDIYSNRILHVL 873
            ||. ||...:|..:...|......:.|.:..| .:.||.:.|....:..|.|.    ...:..:.
Human   779 EVEYPLIEDELRAIDEQLTAATTWLTWQDDCW-GYIERVRAATSELEHRVERT----QKNVKVIQ 838

  Fly   874 MWMQDVSLQILPADDEIWTVDEFLERSEEACRKAAIELNRKSQMVSEAVEEVLSLVDRATAAFKE 938
            ..|:..:..:||.             ..|..|:||..|..|.              |..|..:|.
Human   839 QTMRGWARCVLPP-------------RREHRREAAFTLEDKG--------------DLFTKKYKL 876

  Fly   939 IAGDDVITLFDAATPKGDNSGSGGRKPEDGGGGGGGAAAPSTSGGGGGGQQQDWSILWSCFENPL 1003
            |.||                   |.|..                                     
Human   877 IQGD-------------------GCKIH------------------------------------- 885

  Fly  1004 SLLSTTESLPKGMQDMVCNAVVEMRRYYSRKVIDVLI----KVIRAALDTLRRRFIADENETVFK 1064
            :|:.....|.|      .|..::..:.|...:.|:::    :.|...||.    |:.:..:.:..
Human   886 NLVEENRKLFK------ANPSLDTWKIYVEFIDDIVVEGFFQAIMHDLDF----FLKNTEKQLKP 940

  Fly  1065 KPVFALHAQLQIPHVVIKPNLDELQDILVTAGKNITGIAKGVAQWSSGKDPPQVSMTVQPRVGRN 1129
            .|.|.....|..|.:|.||:||                                           
Human   941 APFFQAQMILLPPEIVFKPSLD------------------------------------------- 962

  Fly  1130 HNESTGGGKSRRRKIYCLASEERPQM----PHMLKSFYSAIMDNK-EVAKAVNQLASCTKNVKPE 1189
             .|:..|......::.|.:.....||    .|:....|...|||. .:|:...::.:...||..:
Human   963 -REAGDGFYDLVEEMLCNSFRMSAQMNRIATHLEIKNYQNDMDNMLGLAEVRQEIMNRVVNVINK 1026

  Fly  1190 IQTYIKRWKPYHFLWKNDRT--TRQLMEFG----------------------LQEFETTLRCLSD 1230
            :..:....:.:.:||.:||.  .:..:.:|                      |::|:..:.....
Human  1027 VLDFRNTLETHTYLWVDDRAEFMKHFLLYGHAVSSDEMDAHANEEIPEQPPTLEQFKEQIDIYEA 1091

  Fly  1231 LDANLLVEPDMEVFGQCVAVYNEKLKYGLAIEIKSCNHKIGQAMKKKYKKEMDYVYAVINEMDRK 1295
            |...:....|..||.....|..:..|..|...||..:....:.:.:.....::.:...|.|.|..
Human  1092 LYVQMSKFEDFRVFDSWFKVDMKPFKVSLLTIIKKWSWMFQEHLLRFVIDSLNELQEFIKETDSG 1156

  Fly  1296 LDRPIR--DLDDVRMIMETLGKIREQEVDMELRIDPIEEAFNVLTRY--------EVQVER--EQ 1348
            |.|.:.  |.|.:..||..|..:|.::...:...:|::|...:|..|        .:|:|.  |:
Human  1157 LQRELNEGDHDGLVDIMVHLLAVRSRQRATDELFEPLKETITLLESYGQKMPEQVYIQLEELPER 1221

  Fly  1349 FDLVDNLRATFQNLLAGALQAQVKLLDMQPAFQDDLRTNLDNFKQDKISYVTEYRTAGPMQAGL- 1412
            ::....:.||.::.::....|:|.|          :|.....|...:..:...:|...|:.... 
Human  1222 WETTKKIAATVRHEVSPLHNAEVTL----------IRKKCILFDAKQAEFRERFRHYAPLGFNAE 1276

  Fly  1413 TPREASDRLILFQNRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLLQKLYKLYNDVID 1477
            .|..|.|:.   ....|.:...:...|....||.:...:|.::.|.|||:.||:.|:.:...|..
Human  1277 NPYTALDKA---NEELEALEEEMLQMQESTRLFEVALPEYKQMKQCRKEIKLLKGLWDVIIYVRR 1338

  Fly  1478 RVSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANK 1542
            .:.::....|.::.:|:::.||..|......|.|.::.|.|:..|:.|:.|.......:..:.:.
Human  1339 SIDNWTKTQWRQIHVEQMDVELRRFAKEIWSLNKEVRVWDAYTGLEGTVKDMTASLRAITELQSP 1403

  Fly  1543 AMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNE 1607
            |::.|||.::|......| ..:|..:|.::|...|.:.::|:..|...|:||...|..:.:::..
Human  1404 ALRDRHWHQLMKAIGVKF-LINEATTLADLLALRLHRVEDDVRRIVDKAVKELGTEKVITEISQT 1467

  Fly  1608 WSVHELQFMSFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSN 1672
            |:..:..:......|..||:.|  .:....||.:.:.|.:||.::|...|.:|:..|...|:.::
Human  1468 WATMKFSYEVHYRTGIPLLKSD--EQLFETLEHNQVQLQTLLQSKYVEYFIEQVLSWQNKLNIAD 1530

  Fly  1673 EILERWLLVQNMWVYLEAVFV-GGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDD 1736
            .::..|:.||..|.:||::|| ..||..||.|:|:||..:|..::::|.:..:...|:......:
Human  1531 LVIFTWMEVQRTWSHLESIFVCSEDIRIQLVKDARRFDGVDAEFKELMFKTAKVENVLEATCRPN 1595

  Fly  1737 LLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDN 1801
            |.:: |..||.:|.:|:|:|:.|||.||:.||||:|||...||:||.:.:....:..||..:||:
Human  1596 LYEK-LKDLQSRLSLCEKALAEYLETKRIAFPRFYFVSSADLLDILSKGAQPKQVTCHLAKLFDS 1659

  Fly  1802 TKSVKF---HDVEYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASL-HSIIRTAYA 1862
            ...::|   .||..::.:.:.|.|.|.:.........|.|||||.||..|.|.:: |||.....|
Human  1660 IADLQFEDNQDVSAHRAVGMYSKEKEYVPFQAECECVGHVETWLLQLEQTMQETVRHSITEAIVA 1724

  Fly  1863 TINDP-NFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGRE--RKVMMETNNKFLEMLNTLID 1924
            ....| ...:..|    |||:.|...|:.||.|..:|..|..|  ...:.:.:.|.:..|||||.
Human  1725 YEEKPRELWIFDF----PAQVALTSSQIWWTTDVGIAFSRLEEGYETALKDFHKKQISQLNTLIT 1785

  Fly  1925 QTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTD 1989
            .....|...:|....|:.||.||.||:...|....:.|...|.||.|.|..:::.....::::.|
Human  1786 LLLGELPPGDRQKIMTICTIDVHARDVVAKLISQKVVSPQAFTWLSQLRHRWEDTQKHCFVNICD 1850

  Fly  1990 VTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVV 2054
            ..|.|..||||.:.|||||||||||||||.|:|.|:|.|||.||||||||||.||:|:.|...|.
Human  1851 AQFQYFYEYLGNSPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGMMVY 1915

  Fly  2055 VFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTD 2119
            |||||:||||:.:|.|||||.|:|:||||||||||.:.||||.|.||.::..|.:.::|.|:|. 
Human  1916 VFNCSEQMDYKSIGNIYKGLVQTGAWGCFDEFNRISVEVLSVVAVQVKMIHDAIRNRKKRFVFL- 1979

  Fly  2120 GDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLAR 2184
            |:.|.:.|..|||||||||||||.|||||||..||..||:.||.::|..:.|.:.||::...|||
Human  1980 GEAITLKPSVGIFITMNPGYAGRTELPENLKALFRPCAMVAPDIELICEILLVAEGFVDARALAR 2044

  Fly  2185 KFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDD 2249
            ||.|||.||:|.|:||.|||:|||.|.|||...|:.||.:....|..::||.|||.|:.|::.||
Human  2045 KFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDKNRPEDQVLMRALRDFNMPKIVTDD 2109

  Fly  2250 EPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLG 2314
            .|:|:.||.||||...:.:......|..:.|.|.|..|.....::||::||.|...|||.:..:|
Human  2110 IPVFLGLVGDLFPALDVPRRRKLHFEQMVRQSTLELRLQPEESFILKVVQLEELLAVRHSVFVVG 2174

  Fly  2315 PSGAGKTTCIHTLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTD---------GIFS 2370
            .:|.||:..:.||.:....|........:||||:|..::||.:..||.:|.|         |:||
Human  2175 NAGTGKSKILRTLNRTYVNMKQKPVWNDLNPKAVTTDELFGFIHHATREWKDGKIVYSYFIGLFS 2239

  Fly  2371 ALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNID 2435
            ::.|:...||.....|:||||.:|.:|||:||:|:||||.||||:.:|:.:.|.::::||.|::.
Human  2240 SILREQANLKHDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPFMRLLFEIHHLR 2304

  Fly  2436 NASPATVSRNGMVYMSSSGLDSRPIVQAWL-KNRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQM 2499
            :|:||||||.|::|::...|...|.|.:|: :.|...||:..:.|||:......:......|...
Human  2305 SATPATVSRAGILYVNPQDLGWNPYVASWIDRRRHQSEKANLTILFDKYVPACLDKLRTSFKTIT 2369

  Fly  2500 PVLQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDANKRLEHQKHVEEARRQSIGSQIVEDL 2564
            .:.:.::||.:..:||.|:                                         ..|::
Human  2370 SIPESSLVQTLCVLLECLL-----------------------------------------TPENV 2393

  Fly  2565 PPETSIEEKEDTCTPEHLHRLY-IFALAWGLGGYL---STSDRQR-MNLFVKESFPQLDYPKGSA 2624
            |.:          :|:.::.:| :||..|..||.|   ..||.|. .:.:.::....:.:|.   
Human  2394 PSD----------SPKEVYEVYFVFACIWAFGGTLLQDQISDYQADFSRWWQKEMKAVKFPS--- 2445

  Fly  2625 HENTIFDFFVS-------PAGVWQSWKTLVTPY-MYPELSTPDYLSILVPIVDNVRIDYLIGTIA 2681
             :.||||::|.       |      |...:..: |.|::...   ::||...:..|:.|.:..:.
Human  2446 -QGTIFDYYVDHKTKKLLP------WADKIAQFTMDPDVPLQ---TVLVHTTETARLRYFMELLL 2500

  Fly  2682 NQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFG 2746
            .:.:.:|::|..|.||||.:.:.:..:: |.|:.....|:..|:....|:.:|..:||:.|..:|
Human  2501 EKGKPLMLVGNAGVGKTVFVGDTLASLS-EDYIVSRVPFNYYTTSTALQKILEKPLEKKAGHNYG 2564

  Fly  2747 PPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPG 2811
            |.|.:|||.||||:|:||::.:|....:.::||.:|...:|..:|. ....|.:.||||.|. |.
Human  2565 PGGNKKLIYFIDDMNMPEVDLYGTVQPHTLIRQHIDYGHWYDRQKV-MLKEIHNCQYVACMN-PM 2627

  Fly  2812 GGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQ 2876
            .|...|..||:|.|.||..|.|..|:::.|:..|...|:. ::.|.|.|......||..|....|
Human  2628 VGSFTINPRLQRHFTVFAFNFPSLDALNTIYGQIFSFHFQ-QQAFAPSILRSGPTLIQATIAFHQ 2691

  Fly  2877 RTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDK 2941
            ......|||..||||:|:|||||.::||::......:.....|:.||.||..||:.|:....:|.
Human  2692 TMMCNFLPTAIKFHYIFNLRDLSNVFQGILFASPECLKGPLDLIHLWLHESARVYGDKLIDKKDC 2756

  Fly  2942 EWFGS---ELACLVREELGDSHSQMILPNP-VFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSH 3002
            :.|..   |.|....|.: |||  |:|..| ::..|        .:.|:|..      |.||...
Human  2757 DLFQRRMLETAYKYFEGI-DSH--MLLQQPLIYCHF--------ADRGKDPH------YMPVKDW 2804

  Fly  3003 EVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKL 3067
            |||:..|...|..:||:  .:.|.||.|.|||.|:.:||||:|.|:|..:||||||||||||::|
Human  2805 EVLKTILTETLDNYNEL--NAAMHLVLFEDAMQHVCRISRILRTPQGCALLVGVGGSGKQSLSRL 2867

  Fly  3068 ASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSS 3132
            |:::.|.:.|||.||..|.:.....||..||...|.:...|.||.||..:.:|.||..:|::|:|
Human  2868 AAYLRGLEVFQITLTEGYGIQELRVDLANLYIRTGAKNMPTVFLLTDAQVLDESFLVLINDLLAS 2932

  Fly  3133 GVISNLFSRDEQAEI-------VQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPV 3190
            |.|.:|||.::..:|       |..|..|..|||..|         ||:||....|.:..|||||
Human  2933 GEIPDLFSDEDVDKIISGIHNEVHALGMVDSRENCWK---------FFMARVRLQLKIILCFSPV 2988

  Fly  3191 GETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFE-IECTPAVKEELVNALGSIQDI 3254
            |.|.|.|.::|||:|:...|||.|.||::|||||:|.|:...: ||  |..|:.:...:..:...
Human  2989 GRTLRVRARKFPAIVNCTAIDWFHAWPQEALVSVSRRFIEETKGIE--PVHKDSISLFMAHVHTT 3051

  Fly  3255 VAETSQEYFQRFRRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEIL 3319
            |.|.|..|:|..||..:.||||:|..|:.:||:.:.||.|:.:..|::..|::|||..::.|..|
Human  3052 VNEMSTRYYQNERRHNYTTPKSFLEQISLFKNLLKKKQNEVSEKKERLVNGIQKLKTTASQVGDL 3116

  Fly  3320 KKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEALVACIAHEKALAEEKLE 3384
            |..|...|.||...:.:||::   :|:..:|.|.|..:..|. |..|..|..|..|....:.:.|
Human  3117 KARLASQEAELQLRNHDAEAL---ITKIGLQTEKVSREKTIA-DAEERKVTAIQTEVFQKQRECE 3177

  Fly  3385 A----AKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCP 3445
            |    |:|||..|..||||:...:::.::....||..:..:...|::|.       .|....|..
Human  3178 ADLLKAEPALVAATAALNTLNRVNLSELKAFPNPPIAVTNVTAAVMVLL-------APRGRVPKD 3235

  Fly  3446 KPSWQESLKMMASA-TFLLQLQNYPKDTINDEMIDLL-QPYFRMEDYNMDMARRVCGDVAGLLSW 3508
            : ||:.:...|... .||..|.||.|:.|.:..:.:: :.|.:..::|.::.|......|||.:|
Human  3236 R-SWKAAKVFMGKVDDFLQALINYDKEHIPENCLKVVNEHYLKDPEFNPNLIRTKSFAAAGLCAW 3299

  Fly  3509 TKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQR 3573
            ...:..|:.|..:|.|.:..|......|..|.:.|....::|.:.:..|..:...::||..||.|
Human  3300 VINIIKFYEVYCDVEPKRQALAQANLELAAATEKLEAIRKKLVDLDRNLSRLTASFEKATAEKVR 3364

  Fly  3574 LTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFR 3638
            ..:..|...:.:..|..|:..|..:|.||....|.|:.|...|.|||||...|:||.||:.:::|
Human  3365 CQEEVNQTNKTIKLANRLVKELEAKKIRWGQSIKSFEAQEKTLCGDVLLTAAFVSYVGPFTRQYR 3429

  Fly  3639 ANLIK-TWMGILKQK-NIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPL 3701
            ..|:. .|:..|:|| :||.|.||::|:||.|.:|::.|..:|||:|.:|.:||.|.|....:||
Human  3430 QELVHCKWVPFLQQKVSIPLTEGLDLISMLTDDATIAAWNNEGLPSDRMSTENAAILTHCERWPL 3494

  Fly  3702 LVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKN 3766
            ::|||.||..|||.|... :|::|.|..|.|...:|.:|:.|..:|||::...:|||:|.:|.:|
Human  3495 VIDPQQQGIKWIKNKYGM-DLKVTHLGQKGFLNAIETALAFGDVILIENLEETIDPVLDPLLGRN 3558

  Fly  3767 FIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVI 3831
            .||.|  :.:.:|||||:....|.|.:.|||.||.:.||:.|:|::::||||..|||.|||..|:
Human  3559 TIKKG--KYIRIGDKECEFNKNFRLILHTKLANPHYKPELQAQTTLLNFTVTEDGLEAQLLAEVV 3621

  Fly  3832 LMEKSDLEAERVALFETVMQN--QRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEV 3894
            .:|:.|||..::.|  |..||  :..:|.||.:||||||:::||.:||..|:|.|..||||..|:
Human  3622 SIERPDLEKLKLVL--TKHQNDFKIELKYLEDDLLLRLSAAEGSFLDDTKLVERLEATKTTVAEI 3684

  Fly  3895 NQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTK 3959
            ..|:..::..||||.:|||.:|.||.|.|:|||:|.::..:|.:||.|||.|.|:|:.:|.::.|
Human  3685 EHKVIEAKENERKINEARECYRPVAARASLLYFVINDLQKINPLYQFSLKAFNVLFHRAIEQADK 3749

  Fly  3960 SSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEE---FLTFIKGG 4021
            ....:.||:|::..:|:.|:.:|:::|:|:.|..|...:|.:|......|...|   .|.|    
Human  3750 VEDMQGRISILMESITHAVFLYTSQALFEKDKLTFLSQMAFQILLRKKEIDPLELDFLLRF---- 3810

  Fly  4022 ASLDLNAVTPKPFRWILDITWLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKPENEEIPCGY 4086
             :::...::|..|  :...:|..:..|:.:|.|..:.:.:|.:.|.||.|.|.|.||.|::|..:
Human  3811 -TVEHTHLSPVDF--LTSQSWSAIKAIAVMEEFRGIDRDVEGSAKQWRKWVESECPEKEKLPQEW 3872

  Fly  4087 --NAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLS 4149
              .:::   :||:|:|:..|||.....:.::||.||.:|.|...|||.:.:.||.|.||...:||
Human  3873 KKKSLI---QKLILLRAMRPDRMTYALRNFVEEKLGAKYVERTRLDLVKAFEESSPATPIFFILS 3934

  Fly  4150 IGSDPTTQIGALAKQKSIVLKS-----VSMGQGQEYHARKMIIESMAIGG-WVLLQNVHLS---L 4205
            .|.|....:..|.|:....:.|     ||:|||||..| ::.:|..:.|| ||:||||||.   |
Human  3935 PGVDALKDLEILGKRLGFTIDSGKFHNVSLGQGQETVA-EVALEKASKGGHWVILQNVHLVAKWL 3998

  Fly  4206 PFCSEIIDMLVESEHIDDSFRMWVTTE-----PHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQ 4265
            ....::::...:..|.|  :|::::.|     ..:..|.|||:.::|.|||||.|:.|:|..:..
Human  3999 GTLEKLLERFSQGSHRD--YRVFMSAESAPTPDEHIIPQGLLENSIKITNEPPTGMLANLHAALY 4061

  Fly  4266 SFTQDFLDYTSATQ-WPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDE 4329
            :|.||.|:..|..| :..:|:::.:.|..|..|.:|||.||:..|.||..|.......:.|:| |
Human  4062 NFDQDTLEICSKEQEFKSILFSLCYFHACVAGRLRFGPQGWSRSYPFNPGDLTICASVLYNYL-E 4125

  Fly  4330 MDPKKGVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYKGYKVPGTKSL 4394
            .:.|  |.|:.|.|:.||:.|||.:|||:|::|...:...:....|..:......|:..|.....
Human  4126 ANSK--VPWEDLRYLFGEIMYGGHITDDWDRKLCRVYLEEFMNPSLTEDELMLAPGFAAPPYLDY 4188

  Fly  4395 QGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGG--GETRESIVYQ 4457
            .|:..||..:...::|.::|||.||:|.:...::..:..|:|.:||:....|.  |::.|..|..
Human  4189 AGYHQYIEEMLPPESPALYGLHPNAEIEFLTVTSNTLFRTLLEMQPRNALSGDELGQSTEEKVKN 4253

  Fly  4458 LADDMLRKLPAQYNAYEV-RENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTI 4521
            :.||:|.|||.::|..|: ::|..|.    |..:...||.:||..:|:.:...|..|.|::.|.:
Human  4254 VLDDILEKLPEEFNMAEIMQKNSNRS----PYVLVCFQECERMNILIREIRISLEQLDLSLKGEL 4314

  Fly  4522 VMSPALKESLDAM-YDARIPETWMKISWEST-TLGFWYTELLERNGQFRTWI-STDRPKVFWMTG 4583
            .:|||::....|: ||. :|:||.|:::.|| .|..|:.:||.|..:..||. ....|.|.|::|
Human  4315 ALSPAVEAQQFALSYDT-VPDTWSKLAYPSTYGLAQWFNDLLLRCRELDTWTQDLTLPAVVWLSG 4378

  Fly  4584 FFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRS 4648
            |||||.||||:.|.:.|.:: |.||...|...:|:..|||....|.||.|:||||:|||..|.::
Human  4379 FFNPQSFLTAIMQTMARKNE-WPLDKTRLTADVTKKTKEDYGHPPREGAYLHGLFMEGARWDTQA 4442

  Fly  4649 GKLIESKMKVLYEQMPVIYIYAINTTAGKDPKLYECPIYRKPQRTDLKYVGSIDFETEFNPKHWT 4713
            |.::|:::|.|...||||:..|......:..:.||||:||...|.. .|:.:...::|.....|.
Human  4443 GTIVEARLKELACPMPVIFAKATPVDRQETKQTYECPVYRTKLRGP-SYIWTFRLKSEEKTAKWV 4506

  Fly  4714 LRGVALLCD 4722
            |.|||||.:
Human  4507 LAGVALLLE 4515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9492NP_001287256.1 DHC_N1 283..843 CDD:285571 131/597 (22%)
DYN1 1178..4372 CDD:227570 1078/3304 (33%)
DHC_N2 1458..1861 CDD:285579 116/408 (28%)
P-loop_NTPase 1994..2222 CDD:304359 139/228 (61%)
P-loop_NTPase 2309..2444 CDD:304359 55/144 (38%)
P-loop_NTPase 2662..2926 CDD:304359 86/264 (33%)
P-loop_NTPase 3025..3287 CDD:304359 115/270 (43%)
MT 3300..3646 CDD:289543 97/353 (27%)
AAA_9 3674..3890 CDD:289547 95/218 (44%)
Dynein_heavy 4031..4713 CDD:281078 233/705 (33%)
DNAH11NP_001264044.1 Stem. {ECO:0000250} 1..1854 440/2083 (21%)
DHC_N1 239..812 CDD:285571 130/583 (22%)
DHC_N2 1319..1722 CDD:285579 116/407 (29%)
P-loop_NTPase 1855..2084 CDD:304359 140/230 (61%)
AAA 1. {ECO:0000250} 1855..2076 137/222 (62%)
AAA 2. {ECO:0000250} 2136..2366 80/230 (35%)
P-loop_NTPase 2169..2313 CDD:304359 55/144 (38%)
P-loop_NTPase 2471..2741 CDD:304359 88/277 (32%)
AAA 3. {ECO:0000250} 2472..2719 83/254 (33%)
AAA 4. {ECO:0000250} 2817..3066 109/262 (42%)
P-loop_NTPase 2818..3085 CDD:304359 117/280 (42%)
Stalk. {ECO:0000250} 3072..3403 91/343 (27%)
MT 3097..3441 CDD:289543 97/356 (27%)
AAA 5. {ECO:0000250} 3459..3686 100/232 (43%)
AAA_9 3468..3680 CDD:289547 95/217 (44%)
Dynein_heavy 3820..4506 CDD:281078 232/704 (33%)
AAA 6. {ECO:0000250} 3896..4122 77/229 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5245
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126558
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.