DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9492 and dnah7

Sequence 1:NP_001287256.1 Gene:CG9492 FlyBaseID:FBgn0037726 Length:4724 Species:Drosophila melanogaster
Sequence 2:XP_690143.4 Gene:dnah7 ZFINID:ZDB-GENE-070912-282 Length:4005 Species:Danio rerio

Alignment Length:4231 Identity:1283/4232 (30%)
Similarity:2087/4232 (49%) Gaps:560/4232 (13%)


  Fly   693 SSLPMAKDLDV-RY----HNVLGILQEYEDEIVSIWLDQDVSVADACLLQPLLSLQGDKLFVNLH 752
            |..|.|.:.|: ||    .|.:|              .:||:..:...|:.:|:|..:.| .:|.
Zfish   133 SGPPTAAEKDILRYCYYIRNGIG--------------TEDVAAMEDSWLKNVLALVPEHL-KSLT 182

  Fly   753 PTIPLLIREAKMLAKLDIELPIVAATLMSRQQYFITIQDSLNCLIKMFLSTVRAVK-LEVRPLFL 816
            .||..|..|                   .|:.|.::|:.:   ::...|...|..| |:.|.| .
Zfish   183 RTIEALSDE-------------------MREDYLLSIKKN---IVDFVLQDPRENKELKARDL-P 224

  Fly   817 PQLVRLTAMLKPGLHTINWTNQNWTEFYERCKQAIES--FDVLVARVHDIYSNRILHVL-MWMQD 878
            |....:..:.||           |.:.:.:.::.:.:  |.|         ::.:|.|| :|  .
Zfish   225 PHRQEMEIIPKP-----------WKKSFLQAQKRMRNNLFTV---------NHTMLEVLGLW--Q 267

  Fly   879 VSLQILPADDEIWTVDEFLERSEEACRKAAIELNRKSQMVSEAVEEVLSLVDRATAAFKEIAGDD 943
            ||.:.|...|    |:.|  .|||    .::||:...|:|::.:|       |||.         
Zfish   268 VSFKKLRLID----VEAF--HSEE----ESMELSVFQQLVNKHIE-------RATG--------- 306

  Fly   944 VITLFDAATPKGDNSGSGGRKPEDGGGGGGGAAAPSTSGGGGGGQQQDWSIL-WSCFENPLSLLS 1007
              .|.:...|:.......|.|..         ..||.|           |:. ...|.|.::.|.
Zfish   307 --ILLNTWIPEVQKIYHRGNKRN---------LIPSNS-----------SVARLQSFYNCVATLM 349

  Fly  1008 TTESLPKGMQDMVCNAVVEMRRYYSRKVIDVLIKVIRAALDTLRRRFIADENET--VFKKPVFAL 1070
            |::     :|.:   |:..|:.|                     ...||....:  |::.|.|.|
Zfish   350 TSQ-----LQSL---ALESMQDY---------------------THLIAQNPHSVRVYEHPGFVL 385

  Fly  1071 HAQLQIPHVVIKPNLDELQDILVTAGKNITGIAKGVAQWSSGKDPPQVSMTVQPRVGRNHNESTG 1135
            ...|....:..:|   :.:|..||.......:.|              |::|.|||         
Zfish   386 RLVLDQNTIKFEP---DFKDFEVTVLNVYNAMLK--------------SLSVIPRV--------- 424

  Fly  1136 GGKSRRRKIYCLASE-ERPQMPHMLKSFYSAIMDNKEVAKAVNQLASCTKNVKPEI----QTYIK 1195
                 ..|:|   || ..|:..|.||..                       :.|||    |..::
Zfish   425 -----ETKLY---SEWPGPETHHTLKPI-----------------------ILPEILEAQQEKVR 458

  Fly  1196 R---------WKPYHFLWKNDRTTRQLMEFGLQEFETTLRCLSDLDANLLVEPDMEVFG------ 1245
            |         .|..|...|......|..|..:.:|.        |:.:...|..|||..      
Zfish   459 RVIRAESAEPLKHVHLYDKYAPLVSQQAEEDVTQFL--------LEQHSFQELMMEVIRYQQLAD 515

  Fly  1246 --QCVAVYNEKLKYGLAIEIKSCNHKIGQAMKKK----YKKEMDYVYAVINEMDRKL-------- 1296
              ||..|  :.::.|: .|:.|  |.:.:|:.|:    .:|.::::.....|.:.||        
Zfish   516 EIQCSTV--KVVRLGM-FELHS--HDLVRALVKRAEGLLQKLVNHMLQGHQEFNNKLCEEYDTIA 575

  Fly  1297 DRPIRDLDDVRMIMET---LGKIREQEV-DMELRIDPIEEAFNVLTRY------EVQVEREQFDL 1351
            ::.:|...:...:||.   :.|:.|:|: .:|:::.........|..|      ::|:..:.|..
Zfish   576 NKALRSPSNTEELMELRAYVAKVEEEEILQLEMKLQESNNRLCFLVDYVTFSPTDIQLNSKTFQR 640

  Fly  1352 VDNLRATFQNLLAGALQAQVKLLDMQPAFQDDLRTNLDNFKQDKISY---VTEYRTAGPMQAGLT 1413
            ...:.:.|.       |.:..:.:....|||.|:...:...:|..||   |.|:...|.:.    
Zfish   641 HARMPSIFD-------QHRQIIKEKTGQFQDGLKLRCERILEDIKSYEQQVEEFVNFGDLS---- 694

  Fly  1414 PREASDRLILFQ---NRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLLQKLYKLYNDV 1475
              |.:..|...|   ::.|.:..:::.....||.|..|.:.||:...::.:|....:||:...:.
Zfish   695 --ELNKYLKKAQSLNSKLELVMEKIRGINQEEEAFDWPVSQYPQRKTVQDQLLPYLRLYETAAEF 757

  Fly  1476 IDRVSSYYDIPWN-------EVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMC 1533
            ..:...:...|..       |||:...:..|.:.:...:.|||.|:   ...::|..::.|.:..
Zfish   758 QSQHHQWVTGPLTAVNPDKVEVDVGNYSRGLYKLEKTFQDLPKPLQ---IATSVKAEVEAFKEHI 819

  Fly  1534 PLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIE 1598
            |:::::.|..::.|||:.:..|..:..:...|...:.:.|...|..|....|.|...|.||..:|
Zfish   820 PIVQVLCNPGLRERHWEAMSAVVGFPLKPSEEDACVAHFLPLHLEAHLSAFESISEGASKEHGLE 884

  Fly  1599 AKLKQVTNEWSVHELQFMSFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQ 1663
            ..::::.:||:..|...:.:...|..:|......:.:  |:|.::...::..:.:..||..:|:.
Zfish   885 KAMERMVSEWAGMEFTLLPYRETGTSILSSLDEVQML--LDDHIVKTQTMRGSPFIKPFEAEIRD 947

  Fly  1664 WVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGV 1728
            |...|....||::.||.||..|:|||.:|...||..|:|:|.:||:.:||:|:..|::......|
Zfish   948 WEDKLLLLQEIMDEWLKVQGTWLYLEPIFSSPDIMAQMPEEGRRFTAVDKTWRDTMKQVSLDKHV 1012

  Fly  1729 VACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQN 1793
            :|....:.:|.: :.|..|.||:..|.|:.|||:||:.||||||:|:..|||||.:..|...:|.
Zfish  1013 LAVVAIEKMLDK-MKHSNELLELILKGLNEYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQP 1076

  Fly  1794 HLLNIFDNTKSVKFHDV-EYNKMMAIISSEGEMIQLDRAI---RAEGSVETWLTQLLVTAQASLH 1854
            ||...|:...||.|.|| :...|.   |||||:::|...|   :|.|.||.||.:|......|:|
Zfish  1077 HLKKCFEGIASVVFTDVLDITHMR---SSEGEVVELLDIISTSKARGQVEKWLLELENGMLRSIH 1138

  Fly  1855 SII-RTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRG-RERKVMMETNNKFLE 1917
            .:| :...|.:||   ..::::...|.|..|...|:.||:|...|:.:| :..:..:|.||..::
Zfish  1139 KVIGKACEAYLND---LRINWVRAWPGQTVLCVSQVYWTKDIHEAIAKGPKALQAYLEQNNTQID 1200

  Fly  1918 MLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDK 1982
            .:.||:   ...|:|:.|.....|:.:.||.||:...|.:..:....:||||.|.|:|:.|:...
Zfish  1201 DIVTLV---RGKLSKQNRVTLGALVVLDVHARDVLASLVQKGVDDETNFEWLSQLRYYWIENQLH 1262

  Fly  1983 TWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGK 2047
            |  .:.:....|..||||.|.||||||||||||.||..||.|.:||||.||||||||||.||:.|
Zfish  1263 T--KMINAGLAYGYEYLGNTPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAK 1325

  Fly  2048 TLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKR 2112
            .:||..|||||||.:||..||:.:|||..:|:|.||||||||:|.||||.|||:..:........
Zfish  1326 AIAKQCVVFNCSDGLDYIALGKFFKGLLSAGAWACFDEFNRIDLEVLSVVAQQILTIQRGISAHA 1390

  Fly  2113 KTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFL 2177
            :..|| :|..:::||...:|||||||||||.|||:|||..||||||||||..:|..:.|.||||:
Zfish  1391 EMLLF-EGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYALIAEIVLYSCGFV 1454

  Fly  2178 ENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDMNL 2242
            ....|:.|....|:||.|||:.|.|||:|:|.:.|||...|..|.:..::.|..:::|.:.|:||
Zfish  1455 RARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKFPEENEDVLLLRSIIDVNL 1519

  Fly  2243 SKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVR 2307
            .|.:..|.|||..:.|||||...|.|.:|..|..||.:.:.:.:|.....:..|::|:||...||
Zfish  1520 PKFLAHDLPLFEGITSDLFPGIKLPKPDYSVLLEAIRENSAKMNLQVTDFFAEKILQIYEMMIVR 1584

  Fly  2308 HGIMTLGPSGAGKTTCIHTLMKAMTQ------MGDNHREMR-MNPKAITAAQMFGRLDVATNDWT 2365
            ||.|.:|....|||:....|..|:..      |.:|..::. :|||:||..|::|:.|..:::|:
Zfish  1585 HGFMLVGEPFGGKTSAYRVLAAALNDICEKNLMEENRVQITVINPKSITMGQLYGQFDPVSHEWS 1649

  Fly  2366 DGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFE 2430
            |||.:..:|.....::.:..||:.|||||::||||:|:||||||.|.|.:|:.:.|:|.:.:|||
Zfish  1650 DGILAVSYRAFAISQSPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMSLIFE 1714

  Fly  2431 PHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPG-----EKSTFSDLFDQTF---VEV 2487
            |.:::.||||||||.||:||....|..||::.:|| |..|.     .|...:.|||:..   :::
Zfish  1715 PMDLEVASPATVSRCGMIYMEPHMLGWRPVMLSWL-NTVPSTLSSMHKDLITGLFDRMLPACLQL 1778

  Fly  2488 YNWGVQMVKLQMPVLQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDANKRLEHQKHVEEAR 2552
            ...|.:.:.   |....::|:.::.:::.::....::.|.            ||:          
Zfish  1779 IRKGTKELS---PTSNTSLVKSLMNLMDCMMDEFGDESQM------------KRM---------- 1818

  Fly  2553 RQSIGSQIVEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLG--------------------GY 2597
                               ::.|.|:  .|..:::|.|.|.:|                    |.
Zfish  1819 -------------------DQRDVCS--WLEGIFVFCLLWSVGASCTEEGRVKFDGLVREMLVGG 1862

  Fly  2598 LSTSDRQRMNLF--VKESFPQLDYP---KGSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELST 2657
            ||...|.|..:.  |:....||..|   :|:.:|   :.|.....|.|:.|...:..:. |....
Zfish  1863 LSEETRTRHGILEHVEPPAKQLTVPLPTEGTLYE---YRFLKEGPGRWELWTEELKAFP-PIPKD 1923

  Fly  2658 PDYLSILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNF-MKKMNVESYMGRSFNFS 2721
            ..:..|:||..:.||.:.|:..:...::..:.:|..||||:|.:.:| :.::..:.|.....|||
Zfish  1924 VQFNEIIVPTENTVRYNALMKLLITHQKPTVFVGPTGTGKSVYILDFLLNRLEKDVYSPLLINFS 1988

  Fly  2722 SATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGF 2786
            :.|:..|.|..|.|.::||....||||.|:|::||:||:|:|....:|.|...|::||.:|...:
Zfish  1989 AQTTAAQTQNIIMSKLDKRRKGVFGPPLGKKMVVFVDDVNMPARETYGAQPPVELLRQWLDHWNW 2053

  Fly  2787 YSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYN 2851
            |.: |......:||:|.:.|||.||||||.:..|..|.|.....|..||.::..||..|.:.|..
Zfish  2054 YDM-KDCSMINLVDIQIMCAMGPPGGGRNPVTPRFLRHFNTVTINEFDNKTMFTIFSRILDWHLT 2117

  Fly  2852 AKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSE 2916
            .:..|.....|:..::|..|..::|...:.|||||||.||:|:|||.||:.||:  .||...|::
Zfish  2118 IRFPFPKPFASVTSQIISATMSVYQEATKNLLPTPAKSHYLFNLRDFSRVIQGI--CLSRPETAD 2180

  Fly  2917 --SVLMALWKHECTRVFADRFTTFQDKEWFGSELACLVREELGDSHSQMI--------------- 2964
              :.:..||.||..||:.||.....|..|....|..:.:..|.:...|:.               
Zfish  2181 DLTAIKRLWVHEVLRVYYDRLVHPDDCAWMVGFLQEVSKSHLNEDFHQLFKHLDSNSDGLVTEDD 2245

  Fly  2965 LPNPVFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVF 3029
            |.:.:|.||    .:|.||:         :.|..|...|.||:.:...|.::|.:.: :.|:||.
Zfish  2246 LRSLMFCDF----HDPKGED---------RNYREVGDAEKLRQVVETHLEEYNNISK-APMNLVL 2296

  Fly  3030 FPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDL 3094
            |..|:.|:.:||||::.|||..:||||||||:||||:||:.:|..:.||:.:::||.|:.:.:||
Zfish  2297 FRFAIEHVCRISRILKQPRGHALLVGVGGSGRQSLTRLAAHMAEAELFQVEISKSYGVSEWRDDL 2361

  Fly  3095 KLLYR------TCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTP 3153
            ||:.:      |.||      |||||..||.|.|||.::|:|::|.:.|||:.||:.||.:.:. 
Zfish  2362 KLIMQKSTSGDTHGV------FLFTDTQIKMESFLEDVSNLLNTGEVPNLFAVDEKQEICERMR- 2419

  Fly  3154 VMKRENQRKTATPESVM---DFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHP 3215
            |:.|:..|...|..|.:   :.||.|..:.|||....||:|:|||||::|||||::.|||||...
Zfish  2420 VLDRQRDRDKQTDGSTLALFNMFLERCRSQLHVVLAMSPIGDTFRSRLRRFPALINCCTIDWFQS 2484

  Fly  3216 WPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRFRRATHVTPKSYLNF 3280
            ||:|||.:||..||.  ::|.|...:|..::...|......:.|..:....:|..:|||.|||..
Zfish  2485 WPEDALQAVASRFLE--DVEMTNTAREGCISMCKSFHTSTIDLSAHFLSELQRYNYVTPTSYLEL 2547

  Fly  3281 IAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVT 3345
            |:.:|::.|.|:.|:.....:.:.||:||:.|:..|..::.:|..::.:|..|:|..|.::|.:.
Zfish  2548 ISMFKHLLQRKRTEVMKLKSRYEVGLQKLESAATQVSTMQGELEALQPQLRVATKEVEEMMVVIQ 2612

  Fly  3346 ERAMQAEIVKNQVLIVKDKAEALVACIAHEKALAEE---KLEAAKPALEEAENALNTIKPAHIAT 3407
            ..:  .|:.|.:.::..|:|||....:| .||:.:|   .|..|.|.||.|..||:|:....|..
Zfish  2613 HES--EEVSKTEKVVRVDEAEANEQAMA-AKAIKDECDADLAVAVPILEAALAALDTLTQQDITL 2674

  Fly  3408 VRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPS---------WQESLKMMASATFLL 3463
            |:.:..||..:..:|:.:.||...|     ||.   .|.||         |..:.|::....||.
Zfish  2675 VKAMKNPPAGVKLVMEAICILKGIK-----PDR---IPDPSGSGKKVEDYWGPAKKLLGDMKFLQ 2731

  Fly  3464 QLQNYPKDTINDEMIDLLQ-PYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKA 3527
            .|..|.||.|....:.::: .|....|:..:..|.......||..|..||..:..|.|.|.|.|.
Zfish  2732 SLHEYNKDNIPVSYMSIIRNKYITNPDFVPEKIRTASAAAEGLCKWVCAMDSYDKVAKVVAPKKE 2796

  Fly  3528 NLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALI 3592
            .|...|.:||:||:.|...:..|:|.::.|..:::..:....:|..|.:...:|.:|:..|..||
Zfish  2797 KLAHAEEKLKVAMESLRKKQAALKEVQDKLAKLQETLETNKNKKADLENQVEMCSKKLERAEQLI 2861

  Fly  3593 NGLSDEKHRWTNQSKEFKIQLGK----LVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKN 3653
            .||..||.||:    |....||:    |.||:|::...::|.|.:...||....:.|:.:.|.:.
Zfish  2862 GGLGGEKSRWS----ETAFNLGQLYNNLTGDILISAAIVAYLGAFTSSFRQRATEEWIDMCKSRG 2922

  Fly  3654 IPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIKCKED 3718
            ||.:..::::|.|.:...:..||:.|||:|..|:.||:|.:.:..:||::|||.|...|:|..|.
Zfish  2923 IPCSKNMSLMNSLGEPVKIRSWTIAGLPSDSFSIDNAIIISNARRWPLMIDPQGQANKWLKNMEK 2987

  Fly  3719 RNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKEC 3783
            .|.|.:..|:...|...||:.:..|.|:|:|:||.:|||:::.:|.|...|.|....:.:||...
Zfish  2988 SNSLHVIKLSDADFVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSVCIRLGDSTI 3052

  Fly  3784 DVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFET 3848
            :..|.|..||||||.||.:.||||.|.::::|.:|..|::|||||.|:..|:.|||.|:.||...
Zfish  3053 EYAPDFRFYITTKLRNPHYLPEVSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALIVQ 3117

  Fly  3849 VMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKARE 3913
            ..:|:|.::|:|..:|..||:|:|::::||..:::|..:|..|.|:::|..|:||||.||.:.|.
Zfish  3118 GAENKRQLQEIEDKILEVLSASEGNILEDETAVQILSSSKVLANEISEKQAIAEVTELKIDQTRL 3182

  Fly  3914 EFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEV 3978
            .:..:|...:||:|.|.:::|:..|||.||..|:.:|..||..|.||.:.|||:.|:..:.||.:
Zfish  3183 GYTPIAIHSAILFFSIADLANIEPMYQYSLTWFINLFIMSIDNSQKSDLLEERLQILKDHFTYSL 3247

  Fly  3979 YKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEEFLTFIKGGASLDLNAVTP--KPFRWILDIT 4041
            |....|||:|:.|.||:..|.:.:..||..:..:|:...:.||..||    .|  .|..|:...:
Zfish  3248 YCNVCRSLFEKDKLLFSFCLTVNLLKHNKLVDEKEWRFLLTGGVGLD----NPHSNPCTWLPKTS 3308

  Fly  4042 WLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKPENEEIPCGYNAILDGFRKLLLIRSWCPDR 4106
            |..:..:.::|.|..:.:.:....:.|:..|:.:.|.:.:.|..:...|..|:::|:||...||:
Zfish  3309 WDEICRLDEMERFKGLRKDLARLREGWKEVYDSKDPHHTDFPSEWQEKLGQFQRMLIIRCLRPDK 3373

  Fly  4107 TISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALAKQKSIV--- 4168
            .:...::::..:||.::.|:...:|...:.:|....|.:.:||.||||...:....:::...   
Zfish  3374 VVPMVQEFVSGNLGQQFIEVPPFNLATAFADSHCCAPLIFILSPGSDPMAALLKFGEEQGFTGNR 3438

  Fly  4169 LKSVSMGQGQEYHARKMIIESMAIGGWVLLQNVHLSLPFCSEI----IDMLVESEHIDDSFRMWV 4229
            |.|:|:||||...|..||...:..|.||:|||.||:..:.|.:    .::..::.|.|  ||:|:
Zfish  3439 LTSLSLGQGQGPIAMSMIETGVKEGTWVVLQNCHLATSWMSTLERVCEELNADTTHPD--FRLWL 3501

  Fly  4230 TTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQSFTQD------FLDYTS-ATQWPPLLYTV 4287
            |:.|...||:.:||..:|.|||.|:|:|:::.|   ||..|      |.|.:| ...:..||:::
Zfish  3502 TSYPSPNFPVAVLQNGVKMTNEAPKGLRSNIIR---SFCMDPISDPEFFDSSSKPAVFKKLLFSL 3563

  Fly  4288 AFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKKGVSWQTLVYMIGEVQYGG 4352
            .|.|.:.||||||||||||||||||:.|...|||.:...||:.:.   :.:..|.||.||..|||
Zfish  3564 CFFHALTQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEE---IPFDALRYMTGECNYGG 3625

  Fly  4353 RVTDDFDKRLLTTFTSVWFCEPLLSNS-FEFYKG--YKVPGTKSLQGFIDYINSLPAYDTPEVFG 4414
            |||||:|:|.|.|..|:::...::::: ::|...  |..|.......:|:|..:||...:||:||
Zfish  3626 RVTDDWDRRTLRTILSIFYTSEIINDADYKFDPSGLYYSPPEGDYNSYIEYTKTLPLNPSPEIFG 3690

  Fly  4415 LHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNA------Y 4473
            :::|||||......:.:.|:||..|.:..||....: :.:|:::|.|:|.|||..::.      |
Zfish  3691 MNANADITKDQVETQLLFDSILLTQSRSSGGSAASS-DDMVFEVAADILNKLPQDFDTDAAMRKY 3754

  Fly  4474 EVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDAR 4538
            ....|.:       ||..|.||:.|..::::.:.....:::.||.|.:|||..|:|.:.::...|
Zfish  3755 PTSYNQS-------MNTVLVQEMGRFNKLLQTIRDSCVNIQKAIKGLVVMSAELEEVVSSILKGR 3812

  Fly  4539 IPETWMKISWES-TTLGFWYTELLERNGQFRTWISTDRPKVFWMTGFFNPQGFLTAMRQEVTRAH 4602
            ||..|||.|:.| ..||.:.::.|||....:.|.....|.||||:|||..|.|||..:|...|.:
Zfish  3813 IPAMWMKKSYPSLKPLGGYISDFLERLKFLQDWYMDGMPAVFWMSGFFFTQAFLTGGQQNYARRY 3877

  Fly  4603 ----KGWALDSVVLQNQITRYNKEDITEY---PTEGVYVHGLFLEGASLDRRSGKLIESKMKVLY 4660
                ...:.|..|::::          ||   |.:|||:.||||:||..|||:.:|.||..|:|:
Zfish  3878 TIPIDLLSFDFEVMEDK----------EYKNPPEDGVYIRGLFLDGARWDRRTKRLAESFPKILH 3932

  Fly  4661 EQMPVIYIYAINTTAGKDPKLYECPIYRKPQRT--------DLKYVGSIDFETEFNPKHWTLRGV 4717
            :.||||::..:......:.:.|..|:|:..:|.        ...||.|:...::..|:||..|||
Zfish  3933 DTMPVIWLKPMKKQDIPERQCYISPVYKTSERRGTLSTTGHSTNYVISMALNSDVPPEHWIRRGV 3997

  Fly  4718 ALLCDI 4723
            ||||.:
Zfish  3998 ALLCQL 4003

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9492NP_001287256.1 DHC_N1 283..843 CDD:285571 32/156 (21%)
DYN1 1178..4372 CDD:227570 1071/3356 (32%)
DHC_N2 1458..1861 CDD:285579 118/415 (28%)
P-loop_NTPase 1994..2222 CDD:304359 131/228 (57%)
P-loop_NTPase 2309..2444 CDD:304359 57/142 (40%)
P-loop_NTPase 2662..2926 CDD:304359 94/267 (35%)
P-loop_NTPase 3025..3287 CDD:304359 113/271 (42%)
MT 3300..3646 CDD:289543 101/363 (28%)
AAA_9 3674..3890 CDD:289547 84/216 (39%)
Dynein_heavy 4031..4713 CDD:281078 228/723 (32%)
dnah7XP_690143.4 DHC_N2 740..1144 CDD:285579 118/413 (29%)
P-loop_NTPase 1272..1502 CDD:304359 131/231 (57%)
P-loop_NTPase 1586..1729 CDD:304359 58/143 (41%)
P-loop_NTPase 1923..2192 CDD:304359 94/272 (35%)
P-loop_NTPase 2284..2555 CDD:304359 114/281 (41%)
MT 2568..2915 CDD:289543 101/362 (28%)
AAA_9 2944..3159 CDD:289547 84/215 (39%)
Dynein_heavy 3299..3993 CDD:281078 227/720 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5245
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126558
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.