DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8319 and AT3G29340

DIOPT Version :9

Sequence 1:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_189580.1 Gene:AT3G29340 / 822592 AraportID:AT3G29340 Length:650 Species:Arabidopsis thaliana


Alignment Length:303 Identity:62/303 - (20%)
Similarity:115/303 - (37%) Gaps:86/303 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CRICGGASENMLGIFD-DQVEEYVDGAKLAEMVKTCADVQLDPDDAMPQKMCISCVHDARTAYGF 68
            |:|||.:.....|:.: .:|...:.| |||                        |          
plant   200 CKICGKSFVCSQGLGNHKRVHREISG-KLA------------------------C---------- 229

  Fly    69 KRRCEENYKKFYLAILNGQVIK-----DEPNEEDFLF-IE-NPDKGNLEAKKKLNKEIK-----K 121
            ||:..|:|..|..::...:::|     :...||..|. :| ..|.|.|.|....:|.|.     |
plant   230 KRKYTEDYNPFSDSLKAKKIVKKPSSFEVSQEEKILHCVELKQDFGELLAHSGFDKSISCSKSIK 294

  Fly   122 THQTASRTTKSSITTSRAGRQLRSIKNQTFKCELCIKQFKRQINLLDHMKVHSNSH--------- 177
            ..:.|.:..|:..:||..|..:..:..:...|:.|.::|.....:..|.::||.:|         
plant   295 VKKVARKNEKTEDSTSLFGVFVGEMSQRLHGCKTCGRKFGTLKGVYGHQRMHSGNHNRIEDENGL 359

  Fly   178 -----------VCQ-NCEERF---LFKADLDNHQCYRNSNSTVECPECLKVFSSTQS-------- 219
                       ||. :..:||   .|.|:::.|:....:.:.|...:.:..|:|..:        
plant   360 ERIWGLKKKSRVCSVSAFDRFKGSSFMAEIEKHEVIEAALNLVMLCQGVYDFASISNLPLGDGFM 424

  Fly   220 -LDSHKC---KDMQE--RSPFQCPHCQQAFTREQNLKAHLLIH 256
             |:...|   :.:|:  ||.::|..|:::|...|.|.:|..:|
plant   425 DLELKPCPLRRKLQKKSRSSYKCSICEKSFVCSQALGSHQRLH 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071 15/74 (20%)
COG5048 <153..368 CDD:227381 29/142 (20%)
C2H2 Zn finger 153..173 CDD:275368 4/19 (21%)
C2H2 Zn finger 179..196 CDD:275368 5/20 (25%)
C2H2 Zn finger 207..227 CDD:275370 4/31 (13%)
C2H2 Zn finger 236..256 CDD:275368 6/19 (32%)
C2H2 Zn finger 268..288 CDD:275368
C2H2 Zn finger 296..316 CDD:275368
zf-H2C2_2 308..332 CDD:290200
zf-C2H2 322..344 CDD:278523
C2H2 Zn finger 324..344 CDD:275368
C2H2 Zn finger 352..368 CDD:275368
AT3G29340NP_189580.1 zf-C2H2_6 43..68 CDD:290623
C2H2 Zn finger 45..65 CDD:275368
C2H2 Zn finger 100..120 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.