DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8319 and Zfp707

Sequence 1:NP_649920.2 Gene:CG8319 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001348393.1 Gene:Zfp707 MGIID:1916270 Length:394 Species:Mus musculus

Alignment Length:291 Identity:90/292 (31%)
Similarity:131/292 (45%) Gaps:23/292 (8%)


  Fly    91 DEPNEEDFLFIENPDKGNLE----AKKKLNKEIKKTHQTASRTTKSSITTSR-------AGRQLR 144
            |||..:|:...|.|| |...    ::|..:..|......|.|  ||::|:.:       :||  |
Mouse   105 DEPWVDDWDRSEFPD-GQKSFCPGSRKVAHSRIGAGRGAALR--KSALTSGKVRLPRATSGR--R 164

  Fly   145 SIKNQTFKCELCIKQFKRQINLLDHMK--VHSNSHVCQNCEERFLFKADLDNHQCYRNSNSTVEC 207
            ..|.:.|:..:|.|..::|.:|.:..:  ......:|..|.:.....:.|..||.......:.||
Mouse   165 MDKREAFQNRICGKSHRKQPDLKEQGQSGPEGQPFICGICGKALSCHSRLAAHQTVHTGTRSFEC 229

  Fly   208 PECLKVFSSTQSLDSHKCKDMQERSPFQCPHCQQAFTREQNLKAHLLIHAESKQGNGPHKCSYCQ 272
            .||.:.|....:|..|:.....|: ||.|..|.|||:.:..|..|..||.|.:    |::|..|.
Mouse   230 LECGRTFRWASNLLRHQRNHTSEK-PFCCELCGQAFSLKDRLAQHRKIHTEHR----PYECGDCG 289

  Fly   273 TGFFNKSALKVHIHAHMGERPHACPFCVSNFRSKQALKVHIRIHTGEKPYQCPHCPKTFSDNNNL 337
            ..|..||.|..|...|.||:|..|..|...||:|:.|..|.|||:|||||.|..|.|.|......
Mouse   290 KAFKQKSNLLRHKLVHTGEKPFYCDTCGKAFRTKENLSHHQRIHSGEKPYTCGECGKAFRWPKGF 354

  Fly   338 AKHRRRHSDERPYKCSICLQDFREKHHLKRH 368
            :.|:|.|..::.|:|..|.:.||......||
Mouse   355 SIHQRLHLTKKFYQCEQCGKGFRHLGFFTRH 385

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071
COG5048 <153..368 CDD:227381 69/217 (32%)
C2H2 Zn finger 153..173 CDD:275368 4/22 (18%)
C2H2 Zn finger 179..196 CDD:275368 4/17 (24%)
C2H2 Zn finger 207..227 CDD:275370 6/20 (30%)
C2H2 Zn finger 236..256 CDD:275368 8/20 (40%)
C2H2 Zn finger 268..288 CDD:275368 7/20 (35%)
C2H2 Zn finger 296..316 CDD:275368 9/20 (45%)
zf-H2C2_2 308..332 CDD:290200 14/24 (58%)
zf-C2H2 322..344 CDD:278523 7/22 (32%)
C2H2 Zn finger 324..344 CDD:275368 6/20 (30%)
C2H2 Zn finger 352..368 CDD:275368 5/16 (31%)
Zfp707NP_001348393.1 KRAB 49..109 CDD:214630 3/4 (75%)
C2H2 Zn finger 174..193 CDD:275368 4/19 (21%)
COG5048 <179..358 CDD:227381 59/184 (32%)
C2H2 Zn finger 201..221 CDD:275368 5/20 (25%)
C2H2 Zn finger 229..249 CDD:275368 6/20 (30%)
C2H2 Zn finger 257..277 CDD:275368 8/20 (40%)
C2H2 Zn finger 285..305 CDD:275368 7/20 (35%)
C2H2 Zn finger 313..333 CDD:275368 9/20 (45%)
C2H2 Zn finger 341..361 CDD:275368 6/20 (30%)
zf-C2H2 367..389 CDD:306579 7/20 (35%)
C2H2 Zn finger 369..389 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.