DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8319 and ZSCAN32

DIOPT Version :9

Sequence 1:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001271456.1 Gene:ZSCAN32 / 54925 HGNCID:20812 Length:697 Species:Homo sapiens


Alignment Length:294 Identity:90/294 - (30%)
Similarity:127/294 - (43%) Gaps:40/294 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 PNEEDFLFIENPDKGNLEAKKKLNKEIKKTHQTASRTT---------KSSITTSRAGRQLRSIKN 148
            ||...|.|.....|.||:.......||.|..|..||..         ..|..|||  ||.|:...
Human   408 PNRLGFEFKNEIKKENLKWDDSEEVEINKALQRKSRGVYWHSELQKGLESEPTSR--RQCRNSPG 470

  Fly   149 QTFKCELCIKQFKRQINLLDHMKVHSNSHVC------QNCEERFLFKADLDNHQCYRNS---NST 204
            ::.  |....|.|     :.|....:....|      :||.:..        |..::.:   ...
Human   471 ESE--EKTPSQEK-----MSHQSFCARDKACTHILCGKNCSQSV--------HSPHKPALKLEKV 520

  Fly   205 VECPECLKVFSSTQSLDSHKCKDMQERSPFQCPHCQQAFTREQNLKAHLLIHAESKQGNGPHKCS 269
            .:||||.|.||.:..|..|:.....|: |.:|..|.:.|:...||.|||..|.    |..|::|.
Human   521 SQCPECGKTFSRSSYLVRHQRIHTGEK-PHKCSECGKGFSERSNLTAHLRTHT----GERPYQCG 580

  Fly   270 YCQTGFFNKSALKVHIHAHMGERPHACPFCVSNFRSKQALKVHIRIHTGEKPYQCPHCPKTFSDN 334
            .|...|...|:|.||...|.||:|:.|..|...|.:......|.||||||.||:|..|.|.|:::
Human   581 QCGKSFNQSSSLIVHQRTHTGEKPYQCIVCGKRFNNSSQFSAHRRIHTGESPYKCAVCGKIFNNS 645

  Fly   335 NNLAKHRRRHSDERPYKCSICLQDFREKHHLKRH 368
            ::.:.||:.|:.|:||:||.|.:.|.:...|.||
Human   646 SHFSAHRKTHTGEKPYRCSHCERGFTKNSALTRH 679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071
COG5048 <153..368 CDD:227381 68/223 (30%)
C2H2 Zn finger 153..173 CDD:275368 4/19 (21%)
C2H2 Zn finger 179..196 CDD:275368 3/22 (14%)
C2H2 Zn finger 207..227 CDD:275370 9/19 (47%)
C2H2 Zn finger 236..256 CDD:275368 8/19 (42%)
C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
C2H2 Zn finger 296..316 CDD:275368 5/19 (26%)
zf-H2C2_2 308..332 CDD:290200 12/23 (52%)
zf-C2H2 322..344 CDD:278523 7/21 (33%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 352..368 CDD:275368 5/15 (33%)
ZSCAN32NP_001271456.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
SCAN 33..142 CDD:128708
SCAN 33..121 CDD:280241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..177
KRAB_A-box 218..250 CDD:295379
Myb_DNA-bind_4 253..334 CDD:290549
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 347..395
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 451..482 10/39 (26%)
COG5048 <455..668 CDD:227381 73/234 (31%)
zf-C2H2 522..543 CDD:278523 9/20 (45%)
C2H2 Zn finger 523..543 CDD:275368 9/19 (47%)
zf-H2C2_2 535..559 CDD:290200 6/24 (25%)
C2H2 Zn finger 551..571 CDD:275368 8/19 (42%)
zf-H2C2_2 563..588 CDD:290200 11/28 (39%)
C2H2 Zn finger 579..599 CDD:275368 7/19 (37%)
zf-H2C2_2 591..616 CDD:290200 10/24 (42%)
C2H2 Zn finger 607..627 CDD:275368 5/19 (26%)
zf-H2C2_2 623..644 CDD:290200 13/20 (65%)
C2H2 Zn finger 635..655 CDD:275368 6/19 (32%)
zf-H2C2_2 647..671 CDD:290200 9/23 (39%)
zf-C2H2 661..683 CDD:278523 8/19 (42%)
C2H2 Zn finger 663..683 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.