DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8319 and CG6654

Sequence 1:NP_649920.2 Gene:CG8319 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster

Alignment Length:620 Identity:131/621 (21%)
Similarity:199/621 (32%) Gaps:253/621 (41%)


  Fly     1 MEDLCRICGGASENMLGIFDDQVEEYVDGAKLAEMVKTCADVQLDPDDAMPQKMCISCVHDARTA 65
            ::.:|..|..::..:|.|:|..     .|:.||:|::.....:...:|.:|:|:|:||:.:....
  Fly     3 VDKICLTCLSSTGPLLSIYDGG-----SGSCLADMIREFTKTKPRRNDNLPEKVCLSCLSEISNC 62

  Fly    66 YGFKRRCEENYKKFYLAILN--------------------------------------------- 85
            |.||.:||.:.:.....:.|                                             
  Fly    63 YTFKIKCENSSRTLRQLLPNALPEEPDSKVSISCPVATTDQAVQTTSWEPDRCTASVQTDAVTTT 127

  Fly    86 ----------------------GQV----IKDEP------------------------------- 93
                                  |:|    :.|||                               
  Fly   128 DAEQNTSLIKSTISVDLDYEGEGEVFDYELPDEPVEKTTSLILQVQGNLKDEKEVVFTQTNVIYE 192

  Fly    94 ----------------------NEEDFLFIENP-----------------DK-----GNLEAKKK 114
                                  ||.:.:.:..|                 ||     |:.|..::
  Fly   193 GDDHELEQQIRECNLAIFEGVDNEAEIITVTAPQVTTRKSAAKLLTQQENDKHQTPVGSKEEARE 257

  Fly   115 LNKEIKKTHQTASRT-----------------------------TKSSITTSRAG---------- 140
            |.||  :..|:|.||                             |:..::..|||          
  Fly   258 LEKE--QVPQSAKRTSRRRGVVKQDVPATPPSDAEPSPKQHRLGTQRKLSAPRAGTVNGPSTTSG 320

  Fly   141 ---------------------------RQLRSIKNQTFKCELCIKQFKRQINLLDHMKVHSNSHV 178
                                       |:.:...|:.:||..|.|.|...    ||:..|..||.
  Fly   321 AATTPELKYHCDRCNAGFAVEKSLMIHRRQKGCINRNYKCNECEKVFVSP----DHLAEHQASHG 381

  Fly   179 CQNCEE---RFLFKADLDNHQCY-RNSNSTVECPECLKVFSSTQSLDSHKCKDMQERSPFQCPHC 239
            ..||.|   |...|..|..|... ...|...:|..|.|||:...:|..|......|: ||.|..|
  Fly   382 AHNCPECGIRCDSKEALSKHMVQGHKRNLRNQCNICQKVFTMLSTLRDHMRIHTGEK-PFVCNIC 445

  Fly   240 QQAFTREQNLKAHLLIHAESKQ------------------------GNGPHKCSYCQTGFFNKSA 280
            .::||:..||:.|.|.|:|:|.                        |:.|.:|..|...|....:
  Fly   446 GKSFTQNANLRQHKLRHSETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCS 510

  Fly   281 LKVHIHAHMGERPHACPFCVSNFRSKQALKVHIRIHTGEKPYQCPHCPKTFSDNNNLAKHRRRHS 345
            |..|...|.||||:||..|...|.:...||.|.|.||||:||.||.|.|||:...:...|:|.|.
  Fly   511 LAKHKRKHTGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQRTHQ 575

  Fly   346 DERPYKCSICLQDFREKHHLKRHFLGKHRDGDQKL 380
            .||.|.|.:|.::|:....::.|..| |...|::|
  Fly   576 GERIYICPVCNEEFKSMPEMRSHLAG-HEQHDKRL 609

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071 20/75 (27%)
COG5048 <153..368 CDD:227381 79/243 (33%)
C2H2 Zn finger 153..173 CDD:275368 6/20 (30%)
C2H2 Zn finger 179..196 CDD:275368 7/20 (35%)
C2H2 Zn finger 207..227 CDD:275370 7/20 (35%)
C2H2 Zn finger 236..256 CDD:275368 8/20 (40%)
C2H2 Zn finger 268..288 CDD:275368 5/20 (25%)
C2H2 Zn finger 296..316 CDD:275368 7/20 (35%)
zf-H2C2_2 308..332 CDD:290200 16/24 (67%)
zf-C2H2 322..344 CDD:278523 9/22 (41%)
C2H2 Zn finger 324..344 CDD:275368 8/20 (40%)
C2H2 Zn finger 352..368 CDD:275368 3/16 (19%)
CG6654NP_650429.1 zf-AD 6..79 CDD:285071 20/78 (26%)
C2H2 Zn finger 331..354 CDD:275368 1/23 (4%)
COG5048 <357..570 CDD:227381 71/218 (33%)
C2H2 Zn finger 360..380 CDD:275368 8/24 (33%)
C2H2 Zn finger 385..406 CDD:275370 6/21 (29%)
C2H2 Zn finger 414..434 CDD:275368 7/20 (35%)
zf-H2C2_2 427..451 CDD:290200 9/25 (36%)
C2H2 Zn finger 442..490 CDD:275368 11/48 (23%)
C2H2 Zn finger 470..487 CDD:275368 0/17 (0%)
zf-H2C2_2 482..507 CDD:290200 5/25 (20%)
C2H2 Zn finger 498..518 CDD:275368 5/20 (25%)
zf-H2C2_2 510..534 CDD:290200 11/24 (46%)
C2H2 Zn finger 526..546 CDD:275368 7/20 (35%)
zf-H2C2_2 539..563 CDD:290200 16/24 (67%)
C2H2 Zn finger 554..574 CDD:275368 8/20 (40%)
C2H2 Zn finger 582..602 CDD:275368 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.