DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8319 and Kr-h1

DIOPT Version :9

Sequence 1:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster


Alignment Length:353 Identity:92/353 - (26%)
Similarity:139/353 - (39%) Gaps:79/353 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 IKDEPNEEDFLFIENPDKGNLEAKKKLNKEIKKTHQTASRTTKSS------ITTSRAG------- 140
            ::|:..:|...|:..    .|..::...::.::.|::.:....::      |.|...|       
  Fly   119 LQDQHQQEQQQFVSY----QLAIQQHQKQQQQQQHESITNAAPTAAPSAQRIKTEPVGGFPASAA 179

  Fly   141 --RQLR--SIKNQTFKCELCIKQFKRQINLLDHMKVHSNS------------------------- 176
              .|:|  |.....|||:.|...|..:.....|.|.||.:                         
  Fly   180 VVSQVRKPSASKPQFKCDQCGMTFGSKSAHTSHTKSHSKNQDLSLNGASGAGVAAPVSTAAIELN 244

  Fly   177 --------------------------HVCQNCEERFLFKADLDNHQCYRNSNSTVECPECLKVFS 215
                                      :.|..|::.|...|.|..|..........||..|.|:||
  Fly   245 DAGLPVGIPKSPTIKPLANVAAGADPYQCNVCQKTFAVPARLIRHYRTHTGERPFECEFCHKLFS 309

  Fly   216 STQSLDSHKCKDMQERSPFQCPHCQQAFTREQNLKAHLLIHAESKQGNGPHKCSYCQTGFFNKSA 280
            ..::|..|:....:|| |::|..|.:||.....|..|:.||.    |..|||||.|:..|.....
  Fly   310 VKENLQVHRRIHTKER-PYKCDVCGRAFEHSGKLHRHMRIHT----GERPHKCSVCEKTFIQSGQ 369

  Fly   281 LKVHIHAHMGERPHAC--PFCVSNFRSKQALKVHIRIHTGEKPYQCPHCPKTFSDNNNLAKHRRR 343
            |.:|:..|.||:|:.|  |.|...|...:.||||.|.|||||||.|..|.:.|..|:.|..||.:
  Fly   370 LVIHMRTHTGEKPYKCPEPGCGKGFTCSKQLKVHSRTHTGEKPYHCDICFRDFGYNHVLKLHRVQ 434

  Fly   344 HSDERPYKCSICLQDFREKHHLKRHFLG 371
            |...:.|||:||.:.|:.|..::.|..|
  Fly   435 HYGSKCYKCTICDETFKNKKEMEAHIKG 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071
COG5048 <153..368 CDD:227381 77/267 (29%)
C2H2 Zn finger 153..173 CDD:275368 5/19 (26%)
C2H2 Zn finger 179..196 CDD:275368 5/16 (31%)
C2H2 Zn finger 207..227 CDD:275370 7/19 (37%)
C2H2 Zn finger 236..256 CDD:275368 6/19 (32%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
C2H2 Zn finger 296..316 CDD:275368 9/21 (43%)
zf-H2C2_2 308..332 CDD:290200 14/23 (61%)
zf-C2H2 322..344 CDD:278523 8/21 (38%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
C2H2 Zn finger 352..368 CDD:275368 5/15 (33%)
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 5/19 (26%)
COG5048 <270..420 CDD:227381 57/154 (37%)
zf-C2H2 271..293 CDD:278523 6/21 (29%)
C2H2 Zn finger 273..293 CDD:275368 6/19 (32%)
zf-H2C2_2 286..309 CDD:290200 6/22 (27%)
C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
zf-H2C2_2 313..338 CDD:290200 9/25 (36%)
C2H2 Zn finger 329..349 CDD:275368 6/19 (32%)
zf-H2C2_2 344..366 CDD:290200 11/25 (44%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
zf-H2C2_2 370..396 CDD:290200 10/25 (40%)
C2H2 Zn finger 385..407 CDD:275368 9/21 (43%)
zf-H2C2_2 400..424 CDD:290200 15/23 (65%)
C2H2 Zn finger 415..435 CDD:275368 7/19 (37%)
zf-C2H2 441..463 CDD:278523 9/22 (41%)
C2H2 Zn finger 443..463 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.