DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8319 and CG2129

Sequence 1:NP_649920.2 Gene:CG8319 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_572449.1 Gene:CG2129 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster

Alignment Length:365 Identity:92/366 (25%)
Similarity:149/366 (41%) Gaps:49/366 (13%)


  Fly    43 QLDPDDAMPQKMCISCV-HDARTAYGFK--RRCEENYKKFYLAILNGQVIKDEPNEEDFLFIENP 104
            |.:.:|..|.:..|... |.:.|:...:  |..:.:||:           :|...||..:.::..
  Fly   117 QDEDEDERPGRSIIKWQDHQSLTSESLRQVRALKVDYKE-----------EDSEQEECGMELDLD 170

  Fly   105 DKGNLEAK---------------KKLNKEIKKTHQTASRTTKSSITTSRAGRQLRSIKN--QTFK 152
            .:|...||               |.|.:.|.:.|:........|........:...:|:  |.:|
  Fly   171 SEGRHSAKIPHSCPHCTKVYQSRKVLERHIMRQHKDTLSPDVDSEDADYEPPKDAPVKSAAQEYK 235

  Fly   153 CELCIKQFKRQINLLDHMK-VHSNSH-------VCQNCEERFLFKADLDNHQCYRNSNSTVECPE 209
            ||.|.|.:..:.:|..|:| .|.|..       .|..||.:......||.|....:..:.  |..
  Fly   236 CEHCGKIYHGKYSLRQHLKRDHDNGEEGGSAIFTCLECEAQLPRLRLLDEHMVQAHGGAA--CVV 298

  Fly   210 CLKVFSSTQSLDSHKCKDMQERSPFQCPH--CQQAFTREQNLKAHLLIHAESKQGNGPHKCSYCQ 272
            |.:.:.:...|..|:.|...||: ..|||  |.:.|...::::.|..:|.|.|.    ..|..|.
  Fly   299 CGRRYKTRHELKRHQLKHTSERN-VPCPHPGCGKRFFTIRHMRNHGKVHTEQKN----FVCESCG 358

  Fly   273 TGFFNKSALKVHIHAHMGERPHACPFCVSNFRSKQALKVHIRIHTGEKPYQCPHCPKTFSDNNNL 337
            ....||..|:|||.:|.||||..|..|...|.|...|:.|:.:|:.|:|:.|..|..|||....|
  Fly   359 YSCRNKETLRVHIRSHTGERPFGCQVCDKRFPSHSGLREHMAMHSTERPHVCSVCGATFSRQKGL 423

  Fly   338 AKHRRRHSDERPYKCSICLQDFREKHHLKRHFLGKHRDGD 377
            ..|:..|:|.:.:.|.:|...:.:...|..| :.|||:.:
  Fly   424 YHHKFLHADTKQFVCKLCGNAYAQAAGLAGH-MRKHRNDE 462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071 9/39 (23%)
COG5048 <153..368 CDD:227381 65/225 (29%)
C2H2 Zn finger 153..173 CDD:275368 7/21 (33%)
C2H2 Zn finger 179..196 CDD:275368 6/17 (35%)
C2H2 Zn finger 207..227 CDD:275370 5/20 (25%)
C2H2 Zn finger 236..256 CDD:275368 6/22 (27%)
C2H2 Zn finger 268..288 CDD:275368 8/20 (40%)
C2H2 Zn finger 296..316 CDD:275368 6/20 (30%)
zf-H2C2_2 308..332 CDD:290200 9/24 (38%)
zf-C2H2 322..344 CDD:278523 7/22 (32%)
C2H2 Zn finger 324..344 CDD:275368 7/20 (35%)
C2H2 Zn finger 352..368 CDD:275368 3/16 (19%)
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 5/20 (25%)
zf-C2H2_8 323..411 CDD:292531 32/92 (35%)
C2H2 Zn finger 327..346 CDD:275368 3/19 (16%)
C2H2 Zn finger 354..374 CDD:275368 8/20 (40%)
zf-H2C2_2 367..389 CDD:290200 11/22 (50%)
C2H2 Zn finger 382..402 CDD:275368 6/20 (30%)
zf-H2C2_2 395..419 CDD:290200 10/24 (42%)
C2H2 Zn finger 410..430 CDD:275368 7/20 (35%)
C2H2 Zn finger 438..458 CDD:275368 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.