DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8319 and si:ch73-144d13.5

Sequence 1:NP_649920.2 Gene:CG8319 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:XP_017206607.2 Gene:si:ch73-144d13.5 ZFINID:ZDB-GENE-131120-187 Length:396 Species:Danio rerio

Alignment Length:329 Identity:100/330 (30%)
Similarity:144/330 (44%) Gaps:36/330 (11%)


  Fly    45 DPD---DAMPQKMCISCVHDARTAYGFKRRCEENYKKFYLAILNGQVIKDEPNEEDFLFIENPDK 106
            ||:   |.||.|.....|::.:   |..:...:|:      |..|:......||:........|.
Zfish    34 DPEQQTDLMPLKEESEEVNEMK---GEPQYENQNF------IAEGKYFSCSNNEKTLSIKRAQDT 89

  Fly   107 GNLEAKKKLNKEIKKTHQTASRTTKSSITTSRAGRQLRSIKNQTFKCELCIKQFKRQINLLDHMK 171
            |:.:..|.::.:|.......||..|.|.|                 |.||.|.||...:..|||:
Zfish    90 GSQQCDKTISNKINHERCVKSRKGKKSYT-----------------CSLCGKSFKHTGHFKDHMR 137

  Fly   172 VHSNS--HVCQNCEERFLFKADLDNHQCYRNSNSTVECPECLKVFSSTQSLDSHKCKDMQERSPF 234
            :|:..  ..||.|.:.|..|..|..|....|......|.:|.|.|.....|..|......|: |:
Zfish   138 IHTGEKPFTCQQCGKSFSRKITLQRHVKIHNEEKPYMCHQCGKSFIQKGYLKVHMKVHTGEK-PY 201

  Fly   235 QCPHCQQAFTREQNLKAHLLIHAESKQGNGPHKCSYCQTGFFNKSALKVHIHAHMGERPHACPFC 299
            .||.|.:.|.::.|.:.|:.||:|.||    |.|.:|...|.....|:.||..|.||:|:.||.|
Zfish   202 TCPQCGRGFIQKGNYRVHMRIHSEEKQ----HTCPHCGKSFNQAGHLRDHIRTHTGEKPYTCPLC 262

  Fly   300 VSNFRSKQALKVHIRIHTGEKPYQCPHCPKTFSDNNNLAKHRRRHSDERPYKCSICLQDFREKHH 364
            ..:|..|...:||:|||:.||...||.|.|:|:...:|..|.|.|:.|:||.|:.|.:.|.:|.|
Zfish   263 GKSFIQKGNYRVHMRIHSEEKQNTCPQCGKSFNQTGHLRDHIRTHTGEKPYTCAQCGKGFNQKSH 327

  Fly   365 LKRH 368
            ...|
Zfish   328 YTVH 331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071 9/37 (24%)
COG5048 <153..368 CDD:227381 77/217 (35%)
C2H2 Zn finger 153..173 CDD:275368 9/20 (45%)
C2H2 Zn finger 179..196 CDD:275368 7/17 (41%)
C2H2 Zn finger 207..227 CDD:275370 6/20 (30%)
C2H2 Zn finger 236..256 CDD:275368 7/20 (35%)
C2H2 Zn finger 268..288 CDD:275368 6/20 (30%)
C2H2 Zn finger 296..316 CDD:275368 9/20 (45%)
zf-H2C2_2 308..332 CDD:290200 12/24 (50%)
zf-C2H2 322..344 CDD:278523 8/22 (36%)
C2H2 Zn finger 324..344 CDD:275368 8/20 (40%)
C2H2 Zn finger 352..368 CDD:275368 5/16 (31%)
si:ch73-144d13.5XP_017206607.2 C2H2 Zn finger 92..111 CDD:275368 3/19 (16%)
C2H2 Zn finger 119..139 CDD:275368 9/20 (45%)
zf-H2C2_2 131..156 CDD:316026 8/25 (32%)
RecG <145..>207 CDD:333223 19/63 (30%)
C2H2 Zn finger 147..167 CDD:275368 7/20 (35%)
C2H2 Zn finger 175..195 CDD:275368 6/20 (30%)
COG5048 <199..350 CDD:227381 53/139 (38%)
C2H2 Zn finger 203..223 CDD:275368 7/20 (35%)
C2H2 Zn finger 231..251 CDD:275368 6/20 (30%)
C2H2 Zn finger 259..279 CDD:275368 9/20 (45%)
C2H2 Zn finger 287..307 CDD:275368 8/20 (40%)
C2H2 Zn finger 315..335 CDD:275368 6/18 (33%)
C2H2 Zn finger 343..363 CDD:275368
zf-H2C2_2 359..380 CDD:316026
C2H2 Zn finger 371..391 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.