DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9427 and OSH1

DIOPT Version :8

Sequence 1:NP_649919.1 Gene:CG9427 / 41164 FlyBaseID:FBgn0037721 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_195778.1 Gene:OSH1 / 831721 AraportID:AT5G01580 Length:233 Species:Arabidopsis thaliana

Alignment Length:215 Identity:56/216 (26%)
Similarity:94/216 (44%) Gaps:29/216 (13%)


  Fly     6 STASLLLLVLSLGWAKLEEKPREKRQSNKLHITLLYESLCPDSRNFMHQLGPVYEEFG--DYIDI 68
            ::.::...:|||.            .|.|:.::|.||:|||....|:....|...|.|  ..||:
plant    10 TSCTIFFCLLSLS------------SSQKVTLSLYYEALCPFCAEFIVNRLPKIFETGLISSIDL 62

  Fly    69 LLVPFGKSQSERNGAIFHCQHGPAECKGNRLQSCVINSTANQAAQVKFVVCQ---MLAPDYSRID 130
            .|||:|.:....:|.|. ||||.|||..|.:.:|.||:..:......::.|.   :|.....:..
plant    63 QLVPWGNAAIRPDGTIL-CQHGEAECALNAIHACAINAYPDVMKHFGYIYCTEQLVLENKLEKWA 126

  Fly   131 QCANEAGLLTDVVHCLSSETGTKLQLQAELVTKQYSPS--FIPTIVYNGVFDQQLQDHSLRDFRG 193
            .|....||....|.|..:..|.:|:.:....|.:..|:  |:|.:|.|.:   .||:    :::.
plant   127 DCLEMVGLSRAAVDCYINGYGNQLEQRYAEETSELYPAHRFVPWVVVNNL---PLQE----NYQN 184

  Fly   194 TVCYMLRQ--QNLLPSSSTI 211
            .|.|:...  .|.:|.:..|
plant   185 FVMYVCNAYGSNQVPEACRI 204

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9427NP_649919.1 GILT 36..136 CDD:281251 32/105 (30%)
OSH1NP_195778.1 GILT 29..130 CDD:281251 32/102 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D803513at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128734
Panther 1 1.100 O PTHR13234
Phylome 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.