DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9427 and ifi30

DIOPT Version :8

Sequence 1:NP_649919.1 Gene:CG9427 / 41164 FlyBaseID:FBgn0037721 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001017196.1 Gene:ifi30 / 549950 XenbaseID:XB-GENE-1002315 Length:256 Species:Xenopus tropicalis

Alignment Length:183 Identity:57/184 (31%)
Similarity:95/184 (52%) Gaps:15/184 (8%)


  Fly    27 REKRQSNK--LHITLLYESLCPDSRNFM-HQLGPVYEEFGDYIDILLVPFGKSQSERNGA---IF 85
            |:.::|::  :.|.|.|||||...|.|: .||.|.:....:.|::.|||:|.:| |.|..   :|
 Frog    49 RDLKKSSEPAIQIDLFYESLCGGCRGFLVRQLFPSWLMLAEIINVTLVPYGNAQ-ETNITGKWVF 112

  Fly    86 HCQHGPAECKGNRLQSCVINSTANQAAQVKFVVCQMLAPDYSR-IDQC----ANEAGLLTDVVHC 145
            .|||||.||.||.:::|:|:...:.......:.|...:.:.:: ::.|    |.|..|.| |:.|
 Frog   113 DCQHGPEECLGNMMEACLIHILDDIYKYFPIIFCMESSNNVTKSLESCLAVYAPELPLKT-VLEC 176

  Fly   146 LSSETGTKLQLQAELVTKQYSP--SFIPTIVYNGVFDQQLQDHSLRDFRGTVC 196
            ::.:.|.||..:....||..||  :::|.||.:|:....||..:.......||
 Frog   177 VNGDLGNKLMHENAQKTKGLSPPHNYVPWIVIDGMHTDDLQAQAQSSLFNLVC 229

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9427NP_649919.1 GILT 36..136 CDD:281251 36/109 (33%)
ifi30NP_001017196.1 GILT 60..161 CDD:281251 34/102 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D477702at33208
OrthoFinder 1 1.000 FOG0001912
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.880

Return to query results.
Submit another query.