DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9427 and ZK669.2

DIOPT Version :8

Sequence 1:NP_649919.1 Gene:CG9427 / 41164 FlyBaseID:FBgn0037721 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_495668.1 Gene:ZK669.2 / 191387 WormBaseID:WBGene00014052 Length:264 Species:Caenorhabditis elegans

Alignment Length:194 Identity:55/195 (28%)
Similarity:86/195 (44%) Gaps:27/195 (14%)


  Fly    35 LHITLLYESLCPD-SRNFMHQLGPVYE--EFGDYIDILLVPFGKSQSERN---GAIFHCQHGPAE 93
            ::|....|||||| :|.|.:.:.||:.  :....|:|...|||.:...|:   |...:|||||||
 Worm    74 INIEFFGESLCPDTTRYFRNHIMPVWTSLQASSTINITYHPFGLASCRRSAETGIRCNCQHGPAE 138

  Fly    94 CKGNRLQSCVINSTANQAAQVKFVVCQMLAPDY-SRIDQCANEAGLLTD-----VVHCLSSETGT 152
            |:.|.||:|||::.......:..|.|......: |.:|.|........|     :..|..|:.|.
 Worm   139 CQLNMLQACVISTLQVPQLYLPIVNCMQGKNKFSSAVDDCIVNFRPRPDLDENFMARCAQSQLGA 203

  Fly   153 KLQLQAELVTKQYSP--SFIPTIVYNGVFDQQLQDHSLRDFRGTVC---------YMLRQQNLL 205
            ||.:|.....|:.:.  .::|.|:.||...|..::    ..:..||         |...|:.|:
 Worm   204 KLMMQHGYRQKEVASELDWVPWILINGRRSQAAEN----QLKTIVCQFSETSKQEYCKTQEELI 263

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9427NP_649919.1 GILT 36..136 CDD:281251 37/107 (35%)
ZK669.2NP_495668.1 GILT 75..178 CDD:281251 36/103 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3160
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D477702at33208
OrthoFinder 1 1.000 FOG0001912
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128734
Panther 1 1.100 O PTHR13234
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.870

Return to query results.
Submit another query.