DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9427 and Y18D10A.2

DIOPT Version :8

Sequence 1:NP_649919.1 Gene:CG9427 / 41164 FlyBaseID:FBgn0037721 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_493240.2 Gene:Y18D10A.2 / 189471 WormBaseID:WBGene00012475 Length:212 Species:Caenorhabditis elegans

Alignment Length:180 Identity:47/181 (26%)
Similarity:69/181 (38%) Gaps:46/181 (25%)


  Fly    43 SLCPDSRNFMH-QLGPVYEEF------GDYIDILLVPFGKSQSERNGAIFHCQHGPAECKGNRLQ 100
            |.|||:..|:| ||.|.|:.:      |..:|...||.|..|.: ...:..|.||..||..|:||
 Worm    45 SRCPDTSKFIHNQLVPFYQNYKGNLSDGLKLDFHAVPTGGHQVD-GKYVNRCLHGALECALNKLQ 108

  Fly   101 ---------------SCVINSTANQAAQVKFVVCQMLAPDYSRIDQCANEAGLLTDVVHCLSSET 150
                           .|:...||..|.    :.|   .||        .|.|.:  |.:|..||.
 Worm   109 MCSKKHIKQDWLVTAGCIQGKTAYSAG----LKC---LPD--------TEEGKI--VQNCAESEE 156

  Fly   151 GTKLQLQAELVTKQYSP--SFIPTIVYNGVFDQQLQDHSLRDFRGTVCYM 198
            |..|...........:|  :::|.|..||..::. .:..|:|   .:|.:
 Worm   157 GEYLLNDENSYRYNVAPHSAWLPWIQVNGERNRN-AEFKLKD---VICQL 202

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9427NP_649919.1 GILT 36..136 CDD:281251 32/115 (28%)
Y18D10A.2NP_493240.2 GILT 39..142 CDD:281251 31/113 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D477702at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13234
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.970

Return to query results.
Submit another query.