DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Kap-alpha3 and Kpna6

Sequence 1:NP_001163572.1 Gene:Kap-alpha3 FlyBaseID:FBgn0027338 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_001015029.2 Gene:Kpna6 RGDID:1306570 Length:541 Species:Rattus norvegicus

Alignment Length:518 Identity:239/519 (46%)
Similarity:330/519 (64%) Gaps:33/519 (6%)


  Fly     8 RLQNFKNKGKDQDEMRRRRNEVTVELRKNKREETILKRRNVPNLDSNTDEEEQLSSSIDLKKLAK 72
            |::::||...:.:||||||.|..::|||.|||:.:.|||||..:    :||..:..|:    |..
  Rat    18 RMKSYKNNALNPEEMRRRREEEGIQLRKQKREQQLFKRRNVELI----NEEAAMFDSL----LMD 74

  Fly    73 AAADATKPEQ-----------------QLAAVQAARKLLSSDKNPPINDLIQS-DILPILVECLK 119
            :...:|..|.                 |||..|..|||||.:.:|||:::|.: .::...||.||
  Rat    75 SYVSSTTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTPGVVDRFVEFLK 139

  Fly   120 QHNHTMLQFEAAWALTNIASGTSAQTNEVVAAGAVPLFLQLLNSPAPNVCEQAVWALGNIIGDGP 184
            :..:..|||||||||||||||||.||..|:.|||||:|::||||...:|.||||||||||.||..
  Rat   140 RSENCTLQFEAAWALTNIASGTSQQTKIVIEAGAVPIFIELLNSDFEDVQEQAVWALGNIAGDSS 204

  Fly   185 LLRDFVIKHGVVQPLLSFIKPDIPITFLRNVTWVIVNLCRNKDPAPPTATIHEILPALNVLIHHT 249
            :.||:|:...::.|||:.:.....:|..||..|.:.||||.|:|.|..|.:...||.|:.|:..:
  Rat   205 VCRDYVLNCSILNPLLTLLTKSTRLTMTRNAVWALSNLCRGKNPPPEFAKVSPCLPVLSRLLFSS 269

  Fly   250 DTNILVDTVWAISYLTDGGNDQIQMVIESGVVPKLIPLLGNSEVKVQTAALRAVGNIVTGSDEQT 314
            |:::|.|..||:|||:||.|::||.||:|||..:|:.||.:::.||.:.|||||||||||.|.||
  Rat   270 DSDLLADACWALSYLSDGPNEKIQAVIDSGVCRRLVELLMHNDYKVASPALRAVGNIVTGDDIQT 334

  Fly   315 QVVLNYDALSYFPGLLSHPKEKIRKEAVWFLSNITAGNQSQVQAVINVGLLPKIIENLSKGEFQT 379
            ||:||..||.....|||..||.|||||.|.:|||||||::|:||||:..:.|.:||.|.|.||:|
  Rat   335 QVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRT 399

  Fly   380 QKEAAWAISNLTISGNREQVFTLIKEGVIPPFCDLLSCQDTQVINVVLDGLNNMLKVAD------ 438
            :|||||||:|.|..|..||:..|:..|.|.|.||||:..|::::.|.|:||.|:|::.:      
  Rat   400 RKEAAWAITNATSGGTPEQIRYLVSLGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEGKRS 464

  Fly   439 -SHVEAVANCIEECEGLAKIERLQSHENVEIYKLAYEIIDQYFTDEGEQTNMAPTSDGAQYNF 500
             |.|......|||..||.|||.||||||.|||:.|:::|:.||..|.:.:::||..|..|..|
  Rat   465 GSGVNPYCGLIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGVEDDDSSLAPQVDETQQQF 527

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Kap-alpha3NP_001163572.1 IBB 7..88 CDD:280005 30/97 (31%)
SRP1 8..500 CDD:227396 238/517 (46%)
ARM 104..224 CDD:237987 61/121 (50%)
armadillo repeat 104..137 CDD:293788 16/34 (47%)
armadillo repeat 145..181 CDD:293788 23/36 (64%)
armadillo repeat 187..222 CDD:293788 11/35 (31%)
ARM 236..350 CDD:237987 62/114 (54%)
armadillo repeat 239..264 CDD:293788 11/25 (44%)
armadillo repeat 272..308 CDD:293788 21/36 (58%)
armadillo repeat 314..348 CDD:293788 20/34 (59%)
ARM 315..433 CDD:237987 63/118 (53%)
armadillo repeat 356..390 CDD:293788 20/34 (59%)
armadillo repeat 399..433 CDD:293788 14/34 (41%)
Arm_3 442..485 CDD:292804 22/43 (51%)
Kpna6NP_001015029.2 IBB 14..107 CDD:280005 30/97 (31%)
SRP1 41..530 CDD:227396 229/496 (46%)
ARM 123..244 CDD:237987 61/121 (50%)
armadillo repeat 131..157 CDD:293788 15/26 (58%)
armadillo repeat 165..201 CDD:293788 23/36 (64%)
armadillo repeat 207..242 CDD:293788 11/35 (31%)
ARM 256..370 CDD:237987 62/114 (54%)
armadillo repeat 259..284 CDD:293788 11/25 (44%)
armadillo repeat 292..328 CDD:293788 21/36 (58%)
armadillo repeat 334..368 CDD:293788 20/34 (59%)
ARM 335..453 CDD:237987 63/118 (53%)
armadillo repeat 376..412 CDD:293788 21/36 (58%)
armadillo repeat 419..453 CDD:293788 14/34 (41%)
Arm_3 469..513 CDD:292804 22/44 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1111872at2759
OrthoFinder 1 1.000 FOG0000186
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.