DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RnpS1 and Pabp2

Sequence 1:NP_649903.1 Gene:RnpS1 FlyBaseID:FBgn0037707 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_476902.1 Gene:Pabp2 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster

Alignment Length:164 Identity:36/165 (22%)
Similarity:60/165 (36%) Gaps:39/165 (24%)


  Fly   198 TPPPKRRERSRSRTRSPSPKQVRIHVGRLTRNVTKDHVFEIFSSFGDVKNVEFPVDRF--HPNFG 260
            |.|....|:....|||       ::||.:....:.:.:...|...|.:..|....::.  ||   
  Fly    82 TVPLSLEEKQEIDTRS-------VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHP--- 136

  Fly   261 RGVAFVEYATPEDCESAMKHMDGGQIDGQEITVSPVVLVKQRPPMRRPSPPMRRPQNNRWRSPPQ 325
            :|.|::|:.:.|..|:|:. |:.....|::|.|.          .:|.:.|.....|       :
  Fly   137 KGFAYIEFGSKEFVETALA-MNETLFRGRQIKVM----------SKRTNRPGLSTTN-------R 183

  Fly   326 FNRFNNRGGGGGGG---------GGRRQSPMRNR 350
            |.|.:.||.|....         |.||....|.|
  Fly   184 FARGSFRGRGARVSRACCHSTFRGARRAMGYRGR 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RnpS1NP_649903.1 RRM <196..>301 CDD:223796 23/105 (22%)
RRM_RNPS1 221..294 CDD:240811 17/75 (23%)
Pabp2NP_476902.1 RRM <43..>172 CDD:223796 23/111 (21%)
RRM_II_PABPN1 97..172 CDD:240994 18/96 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4209
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.