DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and GSTT2

DIOPT Version :10

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_198940.3 Gene:GSTT2 / 834125 AraportID:AT5G41240 Length:591 Species:Arabidopsis thaliana


Alignment Length:172 Identity:50/172 - (29%)
Similarity:83/172 - (48%) Gaps:15/172 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGH-TLIE 81
            :|:...|..|..|.|...:.||.:|...|||.|.  :|...|::|:|||.:|||: :||. .|.|
plant     5 VYADRMSQPSRAVLIFCKVNEIQFDEILISLGKR--QQLSPEFKEINPMGKVPAI-VDGRLKLFE 66

  Fly    82 SVAIMHYLEETRPQ--RPLLPQDVHKRAKVREIVEIICSGIQP-----LQNLIVLIHVG---EEK 136
            |.||:.||......  ....|.|:.||||:..:::...:.::|     :.|.::...:|   ..|
plant    67 SHAILIYLSSAYASVVDHWYPNDLSKRAKIHSVLDWHHTNLRPGASGYVLNSVLAPALGLPLNPK 131

  Fly   137 KKEWAQHWITRGFRAVEKALSTSAGKYCV-GDEISMADCCLV 177
            ....|::.:|.....:|......:.|:.: |.:.|:||..||
plant   132 AAAEAENILTNSLSTLETFWLKGSAKFLLGGKQPSIADLSLV 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 maiA 17..221 CDD:273527 50/172 (29%)
GSTT2NP_198940.3 GST_N_Theta 3..78 CDD:239348 30/75 (40%)
GST_C_Theta 92..221 CDD:198292 18/82 (22%)
NAM-associated 380..488 CDD:464129
DUF5401 <438..588 CDD:375164
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.