DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and GSTT3

DIOPT Version :10

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_198938.1 Gene:GSTT3 / 834124 AraportID:AT5G41220 Length:590 Species:Arabidopsis thaliana


Alignment Length:172 Identity:44/172 - (25%)
Similarity:82/172 - (47%) Gaps:15/172 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGH-TLIE 81
            :|:...|..|..|.|...:.||.:|  .|.:..:..:|...|::::|||.:|||: :||. .|.|
plant     5 VYADRMSQPSRAVLIFCKVNEIQFD--EILIYLANRQQLSPEFKDINPMGKVPAI-VDGKLKLSE 66

  Fly    82 SVAIMHYLEETRPQ--RPLLPQDVHKRAKVREIVEIICSGIQP-----LQNLIVLIHVG---EEK 136
            |.||:.||....|.  ....|.|:.|||::..:::...:.::|     :.|.::...:|   ..|
plant    67 SHAILIYLSSAYPSVVDHWYPTDLSKRARIHSVLDWHHTNLRPGAAGYVLNSVLGPALGLPLNPK 131

  Fly   137 KKEWAQHWITRGFRAVEKALSTSAGKYCVG-DEISMADCCLV 177
            ....|:..:|:....::.........:.:| ::.|:||..||
plant   132 AAAEAEQLLTKSLTTLDTFWLKGNAMFLLGSNQPSIADLSLV 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 maiA 17..221 CDD:273527 44/172 (26%)
GSTT3NP_198938.1 GST_N_Theta 3..78 CDD:239348 26/75 (35%)
GST_C_Theta 92..221 CDD:198292 15/82 (18%)
NAM-associated 378..487 CDD:464129
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.