DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and mars1

DIOPT Version :10

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_068077760.1 Gene:mars1 / 338183 ZFINID:ZDB-GENE-030219-83 Length:942 Species:Danio rerio


Alignment Length:172 Identity:38/172 - (22%)
Similarity:64/172 - (37%) Gaps:62/172 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SLIKSG--------GEQHCNEYREVNPMEQVPALQIDGHTLIESVAIMH------YLEETRPQRP 97
            |:|..|        |..||        ::.:.||::.| ...|:..:.|      ||  |.|..|
Zfish    23 SIIADGEMKLFIGEGNPHC--------LKVLAALELSG-VRCETQLVKHEEKVVPYL--THPVLP 76

  Fly    98 L--LPQDVH----------------KRA--KVREIVEIICSGIQP--LQNLIVLIHVGEEKKKEW 140
            :  ||...|                ::|  ...:.:|...:.:||  ||:|.::...|  |:.|.
Zfish    77 ILQLPSGQHLFSPNSICQYLFDISGQKATDATNQWLEWEATNLQPAVLQSLQLVALQG--KRVEA 139

  Fly   141 AQ------HWITRGFRAVEKALSTSAGKYCVGDEISMADCCL 176
            |.      .|:       |::||.....:...:.:|:||..|
Zfish   140 AAVMKEPLSWL-------EQSLSKRKASFLTDEVVSVADVVL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 maiA 17..221 CDD:273527 38/172 (22%)
mars1XP_068077760.1 GST_N_5 30..101 CDD:436537 16/81 (20%)
GST_C_MetRS_N 104..205 CDD:198340 19/80 (24%)
PLN02610 279..917 CDD:215329
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.