DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and AIMP3

DIOPT Version :10

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_061501516.1 Gene:AIMP3 / 1275730 VectorBaseID:AGAMI1_003941 Length:180 Species:Anopheles gambiae


Alignment Length:72 Identity:19/72 - (26%)
Similarity:29/72 - (40%) Gaps:10/72 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KRAKVREI---VEIICSGIQPLQNLIVLIHVGEEKKKEWAQHWITRGFRAVEKALSTSAGKYCVG 166
            |::.||:.   .|..|..:|.| :..||......|.|..|:..:.      |......:..|.|.
Mosquito    55 KKSSVRQAHSDFETECQILQWL-DYAVLFVAPSNKDKHTAKSLLD------ELNFYLQSRSYLVN 112

  Fly   167 DEISMAD 173
            |.:|:||
Mosquito   113 DTLSVAD 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 maiA 17..221 CDD:273527 19/72 (26%)
AIMP3XP_061501516.1 None

Return to query results.
Submit another query.